(data stored in ACNUC7421 zone)

HOGENOMDNA: ACISJ_3.PE3

ACISJ_3.PE3          Location/Qualifiers
FT   CDS_pept        2149..4158
FT                   /locus_tag="Ajs_0003"
FT                   /gene_family="HOG000136246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /transl_table="11"
FT                   /note="KEGG: tbd:Tbd_1042 putative diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC and GAF sensor(s); TIGRFAM: PAS sensor protein;
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="GI:121592439"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:4671061"
FT                   /translation="MVDGVAQPNAEYVLEGTPSERLLTQRSLVIRDRARERFPRAPVLA
FT                   RTGARSYVGQQLTASDGTPIGMIFVVFRQTLERSRFVSNTLQIFAARAAAELQRQTDDQ
FT                   RIRQQASLLDKARDAIIVRDLEHRITFWNEGAERMYGWSREEVLGRSIATLLYQNPEDF
FT                   LRATQQVMQHGVWSGEILQCDRAGRTLEAEGRWTLVRNDRGEPESVLAINADIGTRKHQ
FT                   EREIQRLAFFDPLTHLPNRVQLLDRVDQALAKAQRLEQGGALLFIDLDNFKTLNDTLGH
FT                   DQGDELLQIVAQRLNTCVRSADTVARLGGDEFVVLVEQLSAHSDTLAEQAGAVGEKILA
FT                   VLSAPYALTGYQHRSTPSIGIALFNHAPTTVGELLKQADLAMYQAKTAGRNTLRFFNPS
FT                   MQHAVAERASLEADLRNALAQKEFLLHYQPQINARGAIVGVEALLRWAHPRRGMVSPGQ
FT                   FIPLAEETGLVLPLGHWVLHTACSVLADWQRVPALAPLTMAVNVSSRQFRDAGFVDDVA
FT                   GVLAATGAPASQLKLELTESLLVEDLAATIATMAALRALGVGFSLDDFGTGYSSLAYLK
FT                   RMPLGQLKIDQSFVRDLLTDPNDAAIVRTIIGLAASLGLEVIAEGVETSAQRDWLAHAG
FT                   CAVYQGYFFSRPLPLDLLEQLLHDHIAAARTPSL"
FT                   /protein_id="YP_984335.1"
     GTGGTCGATG GCGTGGCCCA GCCCAATGCC GAATACGTAC TGGAAGGCAC GCCGAGCGAG        60
     CGGCTGCTGA CCCAGCGCTC GCTGGTCATC CGCGACCGTG CGCGCGAGCG GTTCCCGCGG       120
     GCGCCGGTGC TCGCGCGCAC CGGCGCGCGC AGCTACGTGG GCCAGCAGCT CACGGCCAGC       180
     GACGGCACGC CCATCGGCAT GATCTTCGTG GTGTTCCGCC AGACGCTGGA GCGCAGCCGG       240
     TTCGTCAGCA ACACGCTGCA GATCTTCGCC GCGCGCGCGG CCGCCGAACT GCAGCGCCAG       300
     ACGGACGACC AGCGCATCCG CCAGCAGGCA TCGCTGCTGG ACAAGGCGCG CGACGCCATC       360
     ATCGTGCGCG ACCTGGAGCA CCGCATCACG TTCTGGAACG AGGGCGCAGA GCGCATGTAC       420
     GGCTGGTCGC GCGAGGAGGT CCTCGGCCGC TCCATCGCCA CGCTGCTGTA CCAGAACCCG       480
     GAGGACTTCC TGCGCGCCAC CCAGCAGGTG ATGCAGCACG GCGTGTGGAG CGGCGAGATC       540
     CTGCAGTGCG ACCGCGCGGG CCGCACCCTC GAAGCCGAGG GCCGCTGGAC GCTGGTGCGC       600
     AACGACCGTG GCGAGCCCGA GTCGGTCCTC GCGATCAACG CCGACATCGG CACGCGCAAG       660
     CACCAGGAGC GCGAGATCCA GCGCCTGGCC TTCTTCGACC CGCTCACCCA CCTGCCCAAC       720
     CGCGTGCAGC TGCTGGACCG CGTGGACCAG GCCCTGGCCA AGGCGCAGCG CCTGGAGCAG       780
     GGCGGGGCGC TGCTGTTCAT CGACCTGGAC AACTTCAAGA CCCTCAACGA CACGCTGGGC       840
     CATGACCAGG GGGACGAGCT GCTGCAGATC GTGGCGCAGC GGCTGAACAC CTGCGTGCGT       900
     AGCGCAGACA CGGTGGCGCG CCTGGGCGGC GACGAATTCG TGGTGCTGGT GGAGCAGCTC       960
     AGCGCGCACA GCGACACGCT GGCGGAGCAG GCGGGCGCCG TGGGCGAGAA GATCCTCGCC      1020
     GTGCTCAGCG CCCCCTATGC GCTCACCGGG TACCAGCACC GCAGCACGCC CAGCATCGGC      1080
     ATCGCGCTGT TCAACCACGC GCCCACCACG GTGGGCGAAC TGCTCAAGCA GGCCGACCTG      1140
     GCGATGTACC AGGCCAAGAC CGCGGGACGC AACACGCTGC GCTTTTTCAA CCCGAGCATG      1200
     CAGCATGCCG TGGCCGAGCG TGCCTCGCTC GAGGCGGACC TGCGCAACGC GCTGGCGCAG      1260
     AAAGAGTTTC TGCTGCACTA CCAGCCGCAG ATCAATGCGC GGGGCGCGAT CGTGGGCGTG      1320
     GAGGCGTTGC TGCGCTGGGC GCACCCGCGG CGCGGCATGG TGTCGCCCGG GCAGTTCATT      1380
     CCGCTGGCCG AGGAGACCGG CCTGGTGCTG CCGCTGGGGC ACTGGGTGCT GCACACGGCG      1440
     TGCTCGGTGC TGGCCGATTG GCAGCGGGTG CCGGCGCTGG CGCCGCTGAC CATGGCAGTG      1500
     AATGTGAGCT CGCGCCAGTT CCGCGATGCG GGTTTCGTGG ACGACGTGGC GGGCGTGCTG      1560
     GCCGCCACCG GCGCGCCGGC CTCCCAGCTC AAGCTGGAAC TGACCGAGAG CCTGCTGGTG      1620
     GAGGACTTGG CCGCCACCAT TGCCACCATG GCGGCGCTGC GCGCGCTGGG CGTGGGCTTT      1680
     TCGCTGGACG ACTTCGGCAC CGGCTACTCG TCGCTGGCCT ACCTCAAGCG CATGCCGCTC      1740
     GGGCAGCTCA AGATCGACCA GAGCTTCGTG CGCGACCTGC TCACGGACCC CAACGACGCG      1800
     GCCATCGTGC GCACCATCAT CGGCCTGGCC GCCAGCCTGG GCCTGGAGGT GATCGCCGAG      1860
     GGCGTGGAGA CCAGCGCGCA GCGCGACTGG CTGGCGCACG CCGGCTGCGC GGTGTACCAG      1920
     GGTTACTTTT TCAGCCGGCC GCTGCCGCTG GACCTGCTGG AGCAACTGCT GCACGACCAC      1980
     ATCGCCGCAG CCCGCACGCC GTCTCTTTAA                                       2010
//

If you have problems or comments...

PBIL Back to PBIL home page