(data stored in ACNUC7421 zone)

HOGENOMDNA: ACISJ_3.PE6

ACISJ_3.PE6          Location/Qualifiers
FT   CDS_pept        complement(6572..7177)
FT                   /locus_tag="Ajs_0006"
FT                   /gene_family="HOG000224876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A1159 hypothetical protein"
FT                   /db_xref="GI:121592442"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4671272"
FT                   /translation="MPTIARRSAFFRRTALLSPVPFLAAAAACLTAPPALAQPSEDRAY
FT                   APSVYVQGEWARRQTDAITIGATLPWGTWRRPLWGGELRGHWDVSLSRWSFDGIGGHNS
FT                   AVVVGVAPTLRLRPDEGRSPWFWEAGIGATVASHRYRVQDHEFSTRFNFASHLGLGRNF
FT                   GAQRQHELMLSVQHVSNAGIKSPNPGENFLQLRYALHF"
FT                   /protein_id="YP_984338.1"
     atgcctacca tcgcccgccg cagcgccttt ttccggcgca ccgcccttct ctccccggtg        60
     ccttttctcg cggccgccgc cgcgtgcctc acggccccac cggccctggc gcagccgtca       120
     gaggaccggg cctacgcccc ttcggtctac gtgcagggcg aatgggcgcg gcgccagacg       180
     gatgccatca ccatcggcgc caccctgccc tggggcacct ggcgccgccc gctgtggggc       240
     ggcgagctgc gcggccattg ggatgtttca ctcagccgct ggtcctttga cggcatcggc       300
     gggcacaaca gcgcggtggt ggtgggcgtg gcgcccacgc tgcgcctgcg ccccgacgag       360
     ggccgttccc cctggttctg ggaggccggc atcggtgcca ccgtggccag ccaccgctac       420
     cgcgtgcagg accatgagtt cagcacccgc ttcaactttg cctcgcacct gggcctgggg       480
     cgcaacttcg gcgcacagcg ccagcatgaa ctgatgctga gcgtgcagca cgtgtccaac       540
     gccggcatca agagccccaa ccccggggag aacttcctgc aactgcgcta cgcgttgcac       600
     ttctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page