(data stored in ACNUC7421 zone)

HOGENOMDNA: ACISJ_3.PE7

ACISJ_3.PE7          Location/Qualifiers
FT   CDS_pept        complement(7318..7947)
FT                   /locus_tag="Ajs_0007"
FT                   /gene_family="HOG000220307" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_0029 hypothetical protein"
FT                   /db_xref="GI:121592443"
FT                   /db_xref="GeneID:4671717"
FT                   /translation="MARFKITQRLAATAVAAAVLAGMAVPTLAQPGPGPAATEQGASQA
FT                   QQRPRQRALTPEQREQYMAQRAEAFKRKLQLTPEQEPAWNSFLQSMKPDADARKARLDW
FT                   QGMDQLTTPERIDRMRALRSQRAAEMDRRGDAVKAFYGTLTPAQQKTFDAEGKRMYRHW
FT                   GGDHPMGKRWGKDGARGDFRGDGRGMRHQGPGPGAGAAPGAPLTPQ"
FT                   /protein_id="YP_984339.1"
     atggcccgtt tcaagatcac ccagcgcctg gccgccaccg ccgtggcggc cgctgtgctc        60
     gccggcatgg ctgtgcccac cctggcgcaa cccggccccg gcccagccgc caccgagcaa       120
     ggcgcatccc aggcgcagca gcgtccgcgc cagcgcgccc tgacgcccga gcagcgcgag       180
     cagtacatgg cccagcgcgc cgaggcattc aagcgcaagc tgcagctcac gcccgagcag       240
     gagcccgcat ggaacagctt tctgcagtcc atgaagcccg acgccgacgc acgcaaggcg       300
     cggctggatt ggcaaggcat ggaccagctc accacgcccg agcgcatcga ccgcatgcgc       360
     gcgttgcgct cccagcgcgc ggccgagatg gaccgccgcg gcgacgccgt caaggccttc       420
     tatggcacgc tgacgccggc gcagcaaaag accttcgacg ccgaaggcaa gcgcatgtac       480
     cgccactggg gcggcgacca ccccatgggc aagcgctggg gcaaggacgg tgcgcggggc       540
     gacttccgcg gtgacggtcg cggcatgcgc caccaaggcc ctggcccggg cgcaggcgct       600
     gctcccggcg cgccgctgac gccgcagtaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page