(data stored in ACNUC30630 zone)

EMBL: AE000513.PE113

AE000513.PE113       Location/Qualifiers
FT   CDS_pept        114105..114995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09711"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY36"
FT                   /protein_id="AAF09711.1"
FT                   /translation="MGLVTCRLRALRFRNAPAHEGGMLRLSSGAAPGGSMKYLRALPAV
FT                   SVVALSSALALGGGAQPPIQTTPVPVQTAPAPKPAPVACTQGAWAKAAIDLVTQKGLFI
FT                   GYPDGSFDWCSAITRQEVAQVLARLLAQMPENTFNPAELDTLRQGVAEALAGLEELRAQ
FT                   LAQQNQSIEDLRAQIDELRTALNNMPAAGQGEAGALAPRVPRAKPAPSVPRVLRALRVR
FT                   LAPRVLRVKLVPSVPRAPRVSAARRVTPTFRPPSPSATATTWARPTTASSSRTWARWSA
FT                   SPPATTRSTAASACA"
     gtgggactgg tcacctgccg cctccgggcg ctccggttcc gcaatgcccc agcccacgaa        60
     gggggcatgc tccggctttc gtccggcgct gctccaggag gatctatgaa gtatctgcgt       120
     gctctgcctg ccgtttccgt tgtcgccctg agctcggcgc tcgccctggg tggcggcgct       180
     cagcccccca tccagaccac cccggtgccc gtgcagacgg cccccgcgcc caagcccgct       240
     cccgtcgcct gcacccaggg cgcctgggcc aaggccgcta ttgacctggt gacccagaag       300
     ggcctgttca tcggctaccc cgacggcagc ttcgactggt gcagcgccat cacccgtcag       360
     gaagtcgctc aggtgctcgc ccgcctgctc gcgcagatgc ccgaaaacac cttcaaccct       420
     gccgaactcg acaccctgcg tcagggcgtt gccgaagcgc tcgccggcct ggaagaactg       480
     cgcgcccagc tcgctcagca gaaccagtcc atcgaagacc tgcgcgctca gattgacgag       540
     ctccgtaccg cgctgaacaa catgcccgcc gccggtcagg gcgaagcggg cgcgctggcg       600
     cccagggtcc ccagggcgaa gccggccccg tcggtcccca gggtcctgcg ggcgttgcgg       660
     gtgcgactgg cccccagggt cctcagggtg aagctggtcc cgtcggtccc cagggccccc       720
     agggtgagcg cggcgagaag ggtgacccct acattccgcc cgccgagccc ttccgctacg       780
     gcaactacgt gggcgcggcc tactacagca tcctccagca gaacgtgggc cagatggtcc       840
     gcatcaccgc cggcaacgac cagatctacg gcggcttcgg cgtgcgcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page