(data stored in ACNUC30630 zone)

EMBL: AE000513.PE120

AE000513.PE120       Location/Qualifiers
FT   CDS_pept        120921..121730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09714"
FT                   /db_xref="GOA:Q9RY29"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY29"
FT                   /protein_id="AAF09714.1"
FT                   /translation="MGHPADAPPGSVWEQDLPTLRAVVDAGPALDATLGVPGLPQSGTG
FT                   QSCWLTGTDAVRLMGEHFGPVPGPTLQALLREHGLPGRLTAAGGRAALVNAYSPAYLAG
FT                   GGRRNRLGCFPYAFRAAGLPLNSPDVPALGAGLGLAYASPWAETAPEEDLTRLGEELAG
FT                   ALGQYDLLVADLWLGDLLGHQGREGVPPEVLTAGQAYLRRVDRLLTGAVQAGARVIVSS
FT                   DHGNLEDLSVKSHTLARVPFGAAGLPLPPVADIVQGGGQIGHWLGLP"
     gtggggcacc ccgcagacgc gccgcccggc tcggtgtggg agcaggacct gccgacgctg        60
     cgggccgtgg tggatgcggg ccccgcgctc gacgcgaccc tcggcgtgcc gggcctgccg       120
     cagtcgggca ccggccaaag ctgctggctg accggcacgg acgcggtgcg cctgatgggc       180
     gagcacttcg ggccggtgcc ggggccgacg cttcaagccc tgctgcgcga gcatggtctg       240
     ccgggccgcc tgaccgccgc cggggggcgc gccgcgctgg tcaacgccta ctcgcccgct       300
     tacctcgcgg gcgggggccg ccgcaaccgc ctgggctgtt ttccctacgc tttccgggcg       360
     gcgggcctgc cgctcaattc gccggacgtg cccgcgctgg gagccggtct ggggctggcc       420
     tacgcttcgc cctgggccga gacggcgccg gaagaagacc tcacgcggct gggcgaggag       480
     ctggccgggg cgctgggcca atacgacctg ctggtggccg acttatggct aggcgacctg       540
     ctgggccacc agggccgcga aggggtgccg cccgaagtcc tcaccgccgg gcaggcctac       600
     ctgcgccggg tggaccgcct gctgactggg gcggtgcagg ccggggcgcg ggtcatcgtg       660
     agcagcgacc acggcaatct ggaagacctg agcgtcaaat cacacaccct ggcccgcgtg       720
     cccttcggcg cggcgggctt gcccctcccg ccagtggccg acatcgtgca gggaggcggg       780
     cagataggac actggctggg gctgccctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page