(data stored in ACNUC30630 zone)

EMBL: AE000513.PE121

AE000513.PE121       Location/Qualifiers
FT   CDS_pept        complement(121944..122570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0123"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /note="similar to PID:1054860 SP:Q56320 GB:AE000512 percent
FT                   identity: 57.92; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09715"
FT                   /db_xref="GOA:Q9RY28"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY28"
FT                   /protein_id="AAF09715.1"
FT                   /translation="MSEGKVRVKVCGTTTLPDALHAAAAGADALGFIFAPGSKRRVTAS
FT                   QARGISLNVGPSVARIGVFMGQSLDEVLRTAEAARVSAVQLHGPLPGVYVAAVAGYYPV
FT                   LRVLGPEELQAGNVQAATVQATPGVTLMLDAPQPGSGQPLDWAALVPHFPPGSWLAGGL
FT                   GPDNVAQAIATLRPAGVDAVSRLEASPGLKNPQAVEAFIDAVKRS"
     gtgagtgagg gcaaagtcag ggtcaaggtc tgcggcacca ccaccctccc cgacgccctg        60
     cacgccgccg cagcgggggc cgacgcgctg ggcttcatct tcgcgccggg cagcaagcga       120
     cgggtcacgg caagccaggc ccgcggcatc agcctgaacg tggggccgag cgtggcgcgc       180
     ataggcgttt tcatggggca gtcactcgac gaggtgctgc ggacggcgga ggcggcgcgg       240
     gtcagcgcgg tgcagctgca cggcccgctg ccgggggtat acgtggcggc ggtggccggg       300
     tattatcccg tcttgcgcgt tctgggcccg gaggagcttc aggccgggaa cgtgcaggcc       360
     gcaactgtgc aggcaacccc cggcgtcacc ctgatgctcg acgccccgca gcccggcagc       420
     gggcagccgc tcgactgggc ggcgctggtc ccccactttc cgccgggcag ctggctcgcg       480
     ggcggtctgg gaccggacaa cgtggcgcag gccatcgcca cgctgcggcc cgccggggtg       540
     gacgcggtga gccggctcga agcctcgccc ggcctcaaga atccacaggc cgtcgaagcg       600
     ttcatagacg ccgtaaaacg ctcgtaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page