(data stored in ACNUC30630 zone)

EMBL: AE000513.PE13

AE000513.PE13        Location/Qualifiers
FT   CDS_pept        complement(15101..15862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0014"
FT                   /product="gidB protein"
FT                   /note="similar to GB:D26185 SP:P25813 PID:40027 PID:467384
FT                   GB:AL009126 percent identity: 61.11; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09607"
FT                   /db_xref="GOA:Q9RYD6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYD6"
FT                   /protein_id="AAF09607.1"
FT                   /translation="MIPDALTPAGRELLRRGADDLGLDVAPHEEQFARLLALLRAGNER
FT                   LNLTALKTEEDIVLKHFVDSLTTLRGGHLDGEWKTLDLGTGAGFPALPLAILRPELRLT
FT                   PLDSIRKKIDFVRETAAELGLSNVTPQVGRAETLGQSAEHRGSYDRVVARAVAALPVLA
FT                   ELALPLLRVGGVFVAQKGPLSEEELDAGRRAAGEVGGRIIEVDPFTLPVSGDARTLIVL
FT                   EKQRPTPAKYPRREGVPTHQPLFWKAKEQSR"
     gtgattcccg acgcactgac cccggcgggc cgcgaactgc tgcggcgcgg ggccgacgac        60
     ctgggcctgg acgtggcccc gcacgaggag cagtttgccc ggctgctggc gctcttgcgc       120
     gcgggcaatg agcggctcaa cctcaccgcc ctgaagacgg aagaggacat cgtgctcaag       180
     cacttcgtgg actcgctgac caccctgcgc ggcggtcatt tggacggcga gtggaagacg       240
     cttgacctcg gcaccggcgc gggctttccg gcgctgccgc tcgccatcct gcgccccgag       300
     ctgcggctga ccccgctcga ttccattcgc aagaaaatcg atttcgtgcg cgagaccgcc       360
     gctgaactgg gcctctccaa cgtcaccccg caggtgggcc gcgccgagac actagggcaa       420
     agtgccgagc accgtgggag ctatgaccgg gtggtcgccc gcgccgtggc ggcgctgccg       480
     gtgctcgccg agctggcact cccgctgctg cgcgtcggcg gcgtgttcgt ggcgcaaaag       540
     gggcctctca gcgaagaaga actcgacgcc gggcggcggg cggcaggcga agtcggcggg       600
     cgcatcatcg aagtggaccc cttcaccctg cccgtttcgg gcgacgcccg caccctcatc       660
     gtgctggaaa agcagcgccc caccccggcc aaataccccc gccgtgaggg cgtgccgacc       720
     catcagccgc tcttctggaa agcgaaagaa cagtcccgtt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page