(data stored in ACNUC30630 zone)

EMBL: AE000513.PE136

AE000513.PE136       Location/Qualifiers
FT   CDS_pept        137279..138856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0139"
FT                   /product="GTP-binding protein HflX"
FT                   /note="similar to PID:1653117 percent identity: 60.78;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09728"
FT                   /db_xref="GOA:Q9RY13"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY13"
FT                   /protein_id="AAF09728.1"
FT                   /translation="MRREVGVLIDRRGRVISVSVADARGTEFPDLRLGENRLAGFHLLH
FT                   AHPRGGALSKGDLSTLFLKRLDAVSAIEVGNDGRPGLVHTAHLTPPGTVGEEEDWRILP
FT                   PAQPFEIDEFDLGAQVSALEEEIARAARTREAKKDHERALLVQIDGGEFDAEERLEELG
FT                   ELARTAGAEVVYKELIYRRNLKPGTLVGAGKLEELTSKAYHLDADLLIFGQELGPAQAR
FT                   EIEAATGLKVVDRTQLILDIFALHAQGVESRLQVELAQLRYMKPRLLGAGAQLSRIGGG
FT                   GGSAGGGAIGTRGPGETKLELDRRRINDRLSFLEKQLEGVSQRREERRKSRERNDVPVV
FT                   SIVGYTNAGKSTLLNSFTHAAEEPRRVLAENKLFATLRPTSRQGYIEGIGQVIFTDTVG
FT                   FIRDLPKDLSRAFRSTLEEIGDADVLLHVVDAASPGAEQRLDAVNRILDDLGFRDMPTV
FT                   VALNKADRAEPEVLAREQERTGGIPVSALKNIGLTELKEALGDAVASVQRAELARQEEA
FT                   RAARVEWR"
     gtgcggcgcg aggtcggcgt gctgatcgac cgccggggcc gcgtgatttc ggtcagcgtg        60
     gccgacgccc ggggcaccga gtttcccgac ctgcgtctgg gcgagaaccg tctggcgggg       120
     tttcacctgc tgcacgccca tccccgtggc ggggcgctca gcaagggcga cctctccacg       180
     ctgttcctca agcgcctgga cgcggtttcg gccatcgagg tcggcaacga cgggcgcccc       240
     ggcctggtcc acaccgccca cctgacccct cccggcacgg tgggcgagga agaagactgg       300
     cgcatcttgc cgcccgcgca gcctttcgag atcgacgagt tcgacctcgg cgcgcaggtc       360
     tcggcgctgg aggaagaaat tgcccgcgcg gcccgcaccc gcgaggcgaa aaaggaccac       420
     gaacgggcac tgctggtcca gattgacggg ggcgaattcg acgccgagga gcggctggaa       480
     gaactcggtg agctggcgcg caccgccggg gccgaagtcg tctacaagga actgatctac       540
     cgtcgcaacc tcaaacccgg cacgctggtg ggggcgggca aactggaaga actgacgagc       600
     aaggcctacc acctcgacgc cgacctgctc atcttcggcc aggagctcgg ccccgcccag       660
     gcgcgtgaaa tcgaggcggc gaccgggctc aaggtggtgg accgcaccca gctgattctc       720
     gacatcttcg ctctgcacgc gcagggggtc gagtcgcggc tgcaggtcga actcgcgcag       780
     ctgcgctaca tgaagccgcg gctgctgggg gcgggggcgc agctctcgcg catcgggggc       840
     ggcgggggca gcgccggggg cggggcgatc ggcacacgcg ggccggggga aacgaagctg       900
     gagcttgacc gccgccgcat caacgaccgc ctgagctttc tggaaaagca acttgaaggc       960
     gtgtcgcagc gccgcgagga acgccgcaag agccgcgagc gcaacgacgt gcctgtggtc      1020
     agtatcgtgg gttacacgaa cgctggcaag tccaccctgc tcaactcgtt cacccacgcc      1080
     gccgaagagc cccggcgcgt gttggccgag aacaaactgt tcgccaccct gcgcccgacc      1140
     agccgtcagg gttacattga gggcatcggt caggtcattt ttaccgacac ggtgggcttt      1200
     atccgcgacc tgcccaaaga cctttcgcgg gccttccgct ccacgctgga ggaaatcggc      1260
     gacgccgacg tgctgctgca tgtggtggac gccgcttcac cgggcgccga gcagcgcctg      1320
     gacgcggtga accgcattct ggacgacctc ggtttccgtg acatgcccac cgtggtggcg      1380
     ctgaacaagg ccgaccgcgc tgagccggaa gtgctggcgc gtgaacagga gcgcacaggc      1440
     ggcatccccg tcagcgccct gaaaaacatc ggcctgactg aactgaaaga agccctgggc      1500
     gacgcggtgg cgagcgtgca gcgcgccgaa cttgcccggc aggaagaagc gcgggccgcg      1560
     cgggtggagt ggcgctga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page