(data stored in ACNUC30630 zone)

EMBL: AE000513.PE143

AE000513.PE143       Location/Qualifiers
FT   CDS_pept        complement(147105..149846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0148"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="similar to SP:P96142 PID:1814011 percent identity:
FT                   72.91; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09735"
FT                   /db_xref="GOA:Q9RY06"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY06"
FT                   /protein_id="AAF09735.1"
FT                   /translation="MTDPHTTTLPTQFDPTGIEPKWAARWRSEPFRADATSGKDPFTIV
FT                   IPPPNVTGNLHLGHALDNTLIDTLIRYKRMAGFEALYLPGMDHAGISTQVVVERQLKDA
FT                   GTSRHDLGREAFLEKVWEWKGKSGGMILDQLTRLGVSADWTRERFTMDEGLSRAVRTQF
FT                   VKLYHDGLAYRGERIVNWDPASQTTLSELEIDREVRKGKMYTLSYKLENSAERGSNGET
FT                   GEIRIATVRPETIFADQAIAVHPEDERFRHLVGQKARIPLTDRWVPIIADEAVEMEFGV
FT                   GALKITPAHDPTDFEVGERHGLERPSVIDLDGNLTRDELVPAEFQGLERFAARKAVVKA
FT                   LEESGDLLEQKDHDTAIGLSERTKVPVEPIISEQWFVKMKPFADQVLEGLDKGEIKLVP
FT                   ERYTKVNRDWLENIRDWNISRQLWWGHQIPAWYDKEGNIYVPDPENPELDCDQDPRYAH
FT                   LNLRRDPDVFDTWFSSNLWPFSTLGWPDTDSEDFRKFYPTQVLVTGYDILFFWVARMQM
FT                   AGYGLTGQAPFSTVMLHGLYLDAKGQKMSKSKGNGIDPLELFGQYGVDACRFAFTFLST
FT                   GGQDIKHDARRFEQGRNFANKLWNATRFALMRLGEARIEGSDDLSAYVRAAVTLPDGVL
FT                   LRSKDVLAQLKERDDLTLADRWIISRLNDVTAEASAQLDAFDIGAAIRTLYSFTWDEFC
FT                   DWYIEAAKPELASGNLGTMATLKVVLEHVLKLLHPFMPFITSELYAALGHRRQIAVHSW
FT                   PQPDAALHDAEATKAFDALRSAVDSARSLKSELGLSPQDRLNVAVDGDLADVVRQNARV
FT                   VEGIARVNLVPALEGRTLSQVAPGVTILAPLEGTVDIADWVKKQQKRLAELDKQIKQAQ
FT                   GKLNNEGFVARAPAEVIEEEKRRVADFGAQKERLEGVLAQLG"
     atgaccgacc cccacaccac caccctcccc acgcagttcg accccaccgg catcgagccg        60
     aaatgggccg cccgctggcg cagtgaaccg ttccgcgctg acgccaccag cggcaaagac       120
     ccctttacca tcgtgattcc gccgcccaac gtgaccggca acctgcacct cggacacgcg       180
     ctcgacaaca cgctcatcga caccctgatt cgctacaagc gcatggcggg cttcgaggcg       240
     ctgtacctgc cgggcatgga ccacgcgggc atctccacgc aggtggtggt ggagcggcag       300
     ctcaaggacg ccgggaccag ccgccacgac ctcgggcgcg aggcgttcct tgaaaaagtc       360
     tgggagtgga agggcaaatc cggcggcatg attctcgatc agctcacccg cctgggcgtg       420
     agcgccgact ggacccgcga gcgcttcacg atggacgagg gcctctcgcg cgccgtccgc       480
     acccagttcg tgaagctcta ccacgacggc ctcgcctacc ggggcgagcg catcgtgaac       540
     tgggacccgg cctcacagac cacgctctcc gaactggaaa ttgaccgcga agtgcgcaag       600
     ggcaagatgt acaccctgtc gtacaagctg gaaaactccg ccgagcgcgg gagcaacggc       660
     gaaactggcg aaatccgcat cgccaccgtg cgccccgaaa ccatcttcgc cgaccaggcg       720
     attgctgtgc atcccgagga cgaacgcttc cggcatctgg tgggccagaa ggcgcgcatt       780
     ccgctgaccg accgctgggt gcccatcatc gccgacgaag cggtggagat ggaattcggc       840
     gtcggggcac tgaaaatcac gcccgcgcac gaccccaccg actttgaagt gggcgagcgg       900
     cacggcctgg agcgccccag cgtgattgat ctcgacggca acctcacccg tgacgagctg       960
     gtgcccgccg agtttcaggg tctggaacgc ttcgccgcgc gcaaagcggt ggtgaaggcg      1020
     ctggaagaat ccggcgatct gctggagcaa aaggaccacg acaccgccat cggcctctcc      1080
     gagcgcacca aagtgccggt ggagcccatc atttccgagc agtggttcgt gaagatgaaa      1140
     ccctttgccg accaggtctt ggaaggactg gataagggcg agatcaagct ggtgcccgag      1200
     cgctacacga aggtcaaccg tgactggctg gaaaacatcc gcgattggaa catttcccgg      1260
     cagttgtggt ggggccacca gattccggcg tggtacgaca aagagggcaa catctacgtg      1320
     cccgacccgg aaaaccccga actcgactgc gaccaggacc cccgctacgc gcacctcaat      1380
     ctgcgccgcg atcccgacgt gttcgacacc tggttttcga gcaacctgtg gcccttttcc      1440
     accctcggct ggcctgacac cgacagtgag gacttccgca agttctaccc gacgcaggtg      1500
     ctggtgaccg gctacgacat cctctttttc tgggtggcgc gcatgcagat ggcgggctac      1560
     ggcctgaccg gacaagcacc cttttccacc gtgatgctgc acggcctgta tctggacgcc      1620
     aagggccaga agatgtccaa gagcaagggc aacggcatcg acccgctgga actgtttggg      1680
     cagtacgggg tggacgcctg ccgcttcgcc ttcacgttcc tctcgaccgg cgggcaggac      1740
     atcaagcacg acgcccggcg cttcgagcag ggccgcaact tcgccaacaa gctctggaac      1800
     gccacccgct ttgcgctgat gcgtctgggc gaagcccgaa tcgaggggag cgacgacctc      1860
     tccgcctacg tccgcgccgc cgtgacgctg cccgatggcg tgctgctgcg gagcaaggac      1920
     gtgttggcac agctcaagga gcgcgacgac ctcaccctcg cggaccgctg gattatcagc      1980
     cgcctgaatg acgtgaccgc cgaagcctcc gcgcagctcg atgccttcga catcggcgcc      2040
     gccatccgca cgctgtactc gttcacctgg gacgagttct gcgactggta catcgaggcc      2100
     gccaagcccg aactcgccag cggcaacctc ggcaccatgg cgacgctgaa ggtggtgctg      2160
     gagcacgtgc tcaagctgct gcaccccttc atgccgttca tcacctccga gctgtacgcc      2220
     gcgctggggc accgccgcca gattgccgtg cacagctggc cgcagcccga cgccgctctg      2280
     cacgacgcgg aagccaccaa agctttcgac gcgctgcgct cggcggtgga cagtgctcgc      2340
     agcctcaaga gcgaactggg cctctcgccg caggaccgcc tgaacgtggc ggtggacggc      2400
     gacctcgctg acgtggtgcg acagaacgcc cgcgtggtgg agggcatcgc cagggtgaac      2460
     ctcgtgcccg ctctggaagg ccgcacgctc tcgcaggtgg cccccggcgt gaccatcctc      2520
     gcgccgctgg aaggcacggt ggacatcgcc gactgggtga aaaagcagca aaaacgcctc      2580
     gccgaactcg acaagcagat caagcaggcg cagggcaagc tgaacaacga gggcttcgtg      2640
     gcccgcgccc ccgccgaggt gatcgaggag gagaagcgcc gggtggccga cttcggggcg      2700
     cagaaggagc ggttggaagg agtgttggct cagttggggt ga                         2742
//

If you have problems or comments...

PBIL Back to PBIL home page