(data stored in ACNUC30630 zone)

EMBL: AE000513.PE148

AE000513.PE148       Location/Qualifiers
FT   CDS_pept        153816..154889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0153"
FT                   /product="riboflavin-specific deaminase"
FT                   /note="similar to GB:AE000657 percent identity: 64.83;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09742"
FT                   /db_xref="GOA:Q9RY01"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY01"
FT                   /protein_id="AAF09742.1"
FT                   /translation="MNTEHPPDAEYMQLALNEAAKGLGRTSPNPPVGCVIVRDGEIASE
FT                   IVGRGFHPKAGEPHAEVFALREAGERARGATAYVTLEPCSHDGRTPPCADALIAAGVAR
FT                   VVVAAGDPNPQVNGRGLEKLRAAGIEVATGVLEAAAVRQQAGFRSLVTRGRPHVIYKYA
FT                   MTLDGKVAALNEGNGPVSGPEARARVMAWRNEVDAVAVGARTALLDNPQLNVRGLDGGR
FT                   DPRAVLFDPEGHLPASARAVREGTVLVLREGRSTPLERDPRVTVLHAHSLQGALEQLAG
FT                   LGVATLLLEGGPTLASAFFEAGLIDELRVFVAPKLLGAGLSPLLAPVRSMHAATELAVE
FT                   RVEVVGNDVLVIGGLSV"
     atgaatacgg aacatccgcc tgacgcggaa tacatgcagt tggccctgaa cgaggccgcc        60
     aagggcctgg gccgaaccag cccgaatccg ccggtgggct gcgtcatcgt tcgtgacggt       120
     gaaatcgcca gtgaaatagt ggggcgcggc tttcacccta aggccggaga gccccacgcc       180
     gaggtcttcg cgctgcgtga ggcgggcgag cgggcacgcg gggccaccgc ctacgtcacg       240
     ctcgaaccgt gcagccatga cgggcgcacc ccaccctgcg ccgacgcgct gattgccgct       300
     ggcgtggccc gtgtggtcgt ggcggcgggc gaccccaacc cgcaggtgaa cgggcgcggg       360
     ctggaaaaac tgcgcgcggc gggcatcgag gtcgcaaccg gcgtgctgga agccgcagcc       420
     gtgcgacagc aagccggctt tcgctcgctg gtcacgcggg gccgccccca cgtcatctac       480
     aaatacgcca tgacgctcga cggcaaggtc gccgccctga acgagggcaa cggcccggtc       540
     agcggccccg aagcccgcgc ccgcgtaatg gcgtggcgca acgaggtgga cgccgtggcg       600
     gtgggcgccc gcaccgcgct gctcgacaac ccgcagctca acgtgcgcgg cctggacggc       660
     ggacgcgacc cccgcgccgt gctgtttgac cccgagggcc acctgcccgc cagcgcccgc       720
     gccgtccgtg agggcaccgt gctggtgctg cgcgagggcc ggagcacgcc gcttgaacgc       780
     gacccccgcg tgacggtgct gcacgcccat tcgctgcaag gcgctctgga gcagctcgcc       840
     gggctgggcg tcgccaccct gctgcttgaa ggcggcccca ccctcgccag cgcctttttt       900
     gaagcgggat tgatagacga actgcgcgtc tttgtcgccc ccaaactgct tggcgcgggc       960
     ctctcgccct tgctcgcgcc ggtgcggagt atgcacgcgg cgacggagtt ggcggtggag      1020
     cgggtcgaag tggtcggaaa cgacgttcta gtgattggag gtctaagcgt ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page