(data stored in ACNUC30630 zone)

EMBL: AE000513.PE151

AE000513.PE151       Location/Qualifiers
FT   CDS_pept        156916..157383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0156"
FT                   /product="riboflavin synthase, beta subunit"
FT                   /note="similar to PID:1173519 SP:P50856 percent identity:
FT                   70.59; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09745"
FT                   /db_xref="GOA:Q9RXZ8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXZ8"
FT                   /protein_id="AAF09745.1"
FT                   /translation="MQRIEATLLAHDLKFALVSTRWNHLIVDRLVEGAELAFVQHGGKT
FT                   ENLDHFLVPGSYEVPLVARRLAETGRYDAVVCLGAVIKGDTDHYDFVAGGAANGILNTS
FT                   LHTGVPVAFGVLTTDTVEQALNRAGIKAGNKGGEAVLAMIETANLLKQIER"
     atgcaaagaa tcgaagccac cctcctcgcc cacgacctca agttcgccct cgtcagcacc        60
     cgctggaacc acctcatcgt ggaccggctg gtggagggcg ccgaactcgc cttcgtgcag       120
     cacggcggca agaccgaaaa cctcgaccat ttcctcgttc ccggctccta cgaggtgccg       180
     ctcgtcgccc gccgcctcgc cgaaacgggc cggtacgacg cggtggtgtg cctcggcgcc       240
     gtcatcaagg gcgacaccga ccactacgac ttcgtggcgg gcggcgcggc caacgggatt       300
     ttgaacacct cgctgcacac cggcgtgccc gtcgccttcg gcgtgctgac caccgacacc       360
     gtggagcagg cgctcaaccg cgcgggcatc aaagccggca acaagggcgg cgaggcagtg       420
     ctggcgatga tcgaaacggc gaacctgctc aagcaaatcg agcgctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page