(data stored in ACNUC30630 zone)

EMBL: AE000513.PE158

AE000513.PE158       Location/Qualifiers
FT   CDS_pept        164359..166179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0163"
FT                   /product="ABC transporter, ATP-binding protein, MsbA
FT                   family"
FT                   /note="similar to GB:AL009126 percent identity: 57.83;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09749"
FT                   /db_xref="GOA:Q9RXZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ1"
FT                   /protein_id="AAF09749.1"
FT                   /translation="MSQPAQPSVTRRLYGLLTPYRTAVGAGLLLLLGSVAAELYPPLVW
FT                   IRVVDQGIPARDWGLIGGQLAVLVGVFALQQVLSAWRGVLLERAGQQFTLDLRTAVYRK
FT                   LQSQSADYFETQRTGDLLVRVTGDVDALQDVLVRGTDSVIANALRLVGVIGIFIALQPL
FT                   LGVLTTLPMLAVGLLLWNYGKTVRPAYRAARARLGELSALIADRLAGIRVVQGFAREEA
FT                   EAARVEALGRELYREQARAVALRNRAFPVARFVGNLGNVIMLGGGAWLILAGQFTLGGL
FT                   LAYRGYGRYFYGPIDDLVNISDLLQRAEAAGRRVFAVLDAPVTVADPAHPKPLPTPVRG
FT                   ELHFDNVTFGYDSASYDSASSDPTQPILRGVTLHIPAGQRVALLGASGAGKSTLLGLVT
FT                   RQHDPQSGRVLLDGVDVRDVALAELRTAAAVMPQDTFLFHDTVLENVRYARPDAALAEV
FT                   EEALRAAYALDFVRALPQGLETLVGERGVRLSGGQRQRLAIARTLLARPALLLLDEPTS
FT                   AVDAESEAQVVAALNDLMQGRTSLTVTHRLSLARAADRVLVLDGGVVVEDGPPALLRTR
FT                   GGPYARLEQVAERLERGEVAVISEVVNSSL"
     ttgagccagc ctgcccagcc ctccgtcacc cgccgcctct acgggctgct tacgccctac        60
     cgtaccgccg tgggggcggg gctgctcctg ctgctcggca gtgtggccgc cgaactctac       120
     ccgccgctgg tgtggattcg ggtggtggac caggggattc cggcgcgcga ttggggactt       180
     atcggcggac agctcgccgt gcttgtcggc gtgtttgccc tgcaacaagt gctcagcgca       240
     tggcgggggg tgctgctgga acgggccggg caacagttta cgctcgacct gcggactgcc       300
     gtgtatcgca aattgcagtc gcagtccgcc gactacttcg agacgcagcg gaccggcgac       360
     ctgctcgtcc gggtgaccgg cgacgtggac gcgctgcaag acgtgctggt gcgcggcacc       420
     gattcggtga ttgccaacgc gctgcgcctc gtcggcgtca tcggcatttt catcgccctg       480
     caaccgctgc tcggcgtgct gaccaccctg ccgatgctgg cggtggggct tctactgtgg       540
     aattacggca agaccgtgcg ccccgcctac cgcgccgccc gcgcccggct tggcgaactc       600
     tcggcgctca ttgccgaccg gctcgcgggc atccgggtgg tgcagggctt tgcgcgtgag       660
     gaagcggaag cggcccgcgt agaggcgctc gggcgcgaac tgtaccgcga gcaggcgcgc       720
     gccgtcgcgc tgcgcaaccg ggcctttccc gtcgcccgct tcgtcggcaa cctcggcaac       780
     gtcatcatgc tcggcggcgg cgcgtggctg attctggcgg ggcagttcac cctcggcggc       840
     ctgctcgcct accggggcta cgggcgctat ttctacggcc cgattgacga cctcgtgaac       900
     atttccgacc tgctgcaacg cgccgaagcc gccgggcgcc gggtcttcgc ggtgctcgac       960
     gccccggtaa cggtggctga ccccgcgcac cccaagcctt tgcccactcc cgtgcgcggc      1020
     gaattgcact tcgacaacgt gacctttggc tacgactcag ccagctacga ctccgccagt      1080
     tctgacccca ctcagcccat tctgcgcggt gtcaccctgc acattccggc ggggcagcgc      1140
     gtcgccctgc ttggggcgtc gggggcaggc aaaagcacgc tgctcgggct cgtcacgcgc      1200
     cagcacgacc cccagtcggg ccgggtactc ctagacggcg tggacgtgcg cgacgtggcc      1260
     ctcgccgagc tgcggacggc ggcggcggtg atgccgcagg acaccttcct ctttcacgac      1320
     acggtgctgg aaaacgtgcg ctacgcccgc cccgacgcgg cgctcgccga ggtggaggag      1380
     gcgctgcggg ccgcctacgc gctggacttc gtgcgggcgc tgccgcaggg gctggagacg      1440
     ctggtggggg agcgcggcgt gcggctctcg ggcggtcagc gccagcgcct cgccattgcc      1500
     cgcacgctgc ttgcccggcc cgcgctgctg ctgcttgacg aacccacgag cgcggtggac      1560
     gccgagtccg aggcgcaggt ggtcgccgcc ctgaatgacc tgatgcaggg ccgcacctcg      1620
     ctcacggtga cccaccgcct gagcctcgcc cgcgccgccg accgggtgct ggtgctcgac      1680
     ggcggcgtgg tggtggaaga cggcccgccc gcgctgctca ggacgcgcgg cggcccctac      1740
     gcccggctcg aacaggtggc cgagcggctc gaacgcggcg aggtggcggt gatttcagaa      1800
     gttgtcaact cctcactgta a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page