(data stored in ACNUC30630 zone)

EMBL: AE000513.PE160

AE000513.PE160       Location/Qualifiers
FT   CDS_pept        complement(167294..169261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0165"
FT                   /product="acyl-peptide hydrolase, putative"
FT                   /note="similar to GB:AL009126 percent identity: 56.01;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09754"
FT                   /db_xref="GOA:Q9RXY9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:5YZM"
FT                   /db_xref="PDB:5YZN"
FT                   /db_xref="PDB:5YZO"
FT                   /db_xref="PDB:6IGP"
FT                   /db_xref="PDB:6IGQ"
FT                   /db_xref="PDB:6IGR"
FT                   /db_xref="PDB:6IKG"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY9"
FT                   /protein_id="AAF09754.1"
FT                   /translation="MNNSETPAPGPDSLLALAFPSDPQVSPDGKQVAFVLAQISEEDPA
FT                   KPDKDFARPRYRSGLWLSEGGAARPLTHAETGRGDSAPRWSPDGQNLAFVRSAGEVKAA
FT                   LMLLPLKGGEARRVTHFKNGVSGPQWSPDGRFIAFTTTADTEDKRDERGEARVLTRPVY
FT                   RANGADWLPERPAALWLYDVEADKLREWYAPEIGIGALSWWPDSRGVLIVQSEDEWQAS
FT                   QWRQDVYDLPLPTADAPAAPQKLLDWNSAAHGLAPHPDGQRFALIGRPAGKGNTEHAHL
FT                   YLIENGQHRRLDTGHDHPVGDAVGGDCHVGAFPEGPRWLDGDTLLFSSTVRGSVGLFTA
FT                   HIGGGVKAYDHDPQGVISAFTANEHGVALIRESATRFPEVELNGQRVTDLHARFPFPVR
FT                   EPQRVTFETELGEGEGWVLLPEGEQKVPALLNIHGGPHTDYGHGFTHEFQLMAARGYGV
FT                   CYSNPRGSVGYGQAWVDAIYGRWGTVDADDLLNFFDRCLEAVPRLDAAKTAVMGGSYGG
FT                   FMTNWITGHTTRFQAAITDRCISNLISFGGTSDIGLRFWDDELGLDFSRRADALKLWDL
FT                   SPLQYVENVKTPTLIVHSVLDHRCPVEQAEQWYAALHKHQVPVRFVRFPEENHELSRSG
FT                   RPDRRLTRLNEYFAWLERWL"
     atgaacaatt cggaaacccc ggcccccggc ccagattccc tgctggccct cgcttttccc        60
     tccgacccgc aggtgtcgcc ggacggcaag caggtggcct tcgtgctggc gcaaatctcg       120
     gaagaagacc ccgccaaacc cgacaaagac tttgcccgcc cgcgctaccg ctctggcctg       180
     tggctctcgg aagggggggc ggcgcggcca ctcacccacg ccgaaacggg acgcggcgac       240
     tcggcccccc gctggtcgcc cgacggtcag aacctggcct ttgtccgcag tgcgggcgag       300
     gtgaaggcgg cgctgatgct gctcccactc aagggcggcg aggcgcggcg cgtgacccat       360
     ttcaagaacg gcgtgagcgg gccgcagtgg agtccagacg ggcggtttat cgcctttacc       420
     accacggctg ataccgagga caagcgcgac gaacgtggag aagcccgcgt gctgacccgg       480
     cccgtgtacc gcgccaacgg agccgactgg ctgcccgagc ggcccgccgc gctgtggctc       540
     tacgacgtgg aggccgacaa actgcgcgag tggtacgcgc ccgaaatcgg catcggggcg       600
     ctgtcgtggt ggcccgattc acgcggcgtg ctgatcgtgc agagcgagga cgagtggcag       660
     gcgagccagt ggcgtcagga cgtgtatgac ctgccgctgc ccactgccga cgcgcccgct       720
     gccccgcaga agcttctgga ctggaactcg gcggcgcacg ggctggcccc gcaccccgac       780
     ggccagcgct tcgccttgat tggccggccc gccgggaagg gcaacaccga gcacgcacac       840
     ctctacttga ttgagaatgg gcagcaccgc cggctggaca ccgggcacga ccacccggtc       900
     ggtgacgcgg tgggcggcga ctgccacgtg ggggcctttc cggaagggcc gcgctggctg       960
     gacggcgaca cgctgctctt ttcgtccacc gtgcgcggca gcgtaggcct gttcaccgcc      1020
     cacatcggcg gcggggtgaa ggcctacgac cacgacccgc agggcgtcat ctcggcgttc      1080
     acggccaacg aacacggcgt cgcgctgatt cgggaatcgg cgacccggtt tcccgaggtg      1140
     gaactgaacg ggcagcgtgt caccgacctg cacgcccgct ttccttttcc ggtgcgcgag      1200
     ccgcagcgcg tcacgtttga gaccgaactc ggcgaggggg agggctgggt gctgctgccg      1260
     gaaggtgagc agaaagtgcc cgcgctgctc aatattcacg gcgggccgca caccgactac      1320
     gggcacggct ttacccacga gttccagctg atggcggcgc gcggctacgg cgtgtgctac      1380
     tccaacccgc gcggctcggt gggctacggg caggcgtggg tggacgccat ctacgggcgc      1440
     tggggcacgg tggacgcgga cgacctgctg aacttcttcg accgctgcct ggaagcggtg      1500
     ccgcgcctgg acgccgcaaa aaccgccgtc atgggcggca gctacggcgg cttcatgacc      1560
     aactggatca ccgggcacac cacccgtttt caggccgcca tcaccgaccg ctgcatcagc      1620
     aacctgattt cgttcggggg cacgtccgac atcgggctgc gcttctggga cgacgagctg      1680
     gggctggact tctcgcgccg ggcggacgcg ctgaagctct gggacctttc gccactgcaa      1740
     tacgtggaaa acgtgaagac gccgaccctg atcgtccatt cggtccttga ccaccgctgc      1800
     cctgtcgagc aagccgagca gtggtacgcc gcgctgcaca agcatcaggt gccggtgcgc      1860
     ttcgtgcgct tccccgagga aaaccacgaa ctgtcgcgct cgggccggcc cgacagacgg      1920
     ctgacgcggc tgaacgagta cttcgcctgg ctggaacgct ggctgtaa                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page