(data stored in ACNUC30630 zone)

EMBL: AE000513.PE161

AE000513.PE161       Location/Qualifiers
FT   CDS_pept        169313..169567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0166"
FT                   /product="acyl-CoA-binding protein"
FT                   /note="similar to SP:P31787 PID:1323021 PID:1620454
FT                   PID:170970 percent identity: 66.09; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09755"
FT                   /db_xref="GOA:Q9RXY8"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR022408"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY8"
FT                   /protein_id="AAF09755.1"
FT                   /translation="MNFEQAQQEVNTLSKKPGNDVLLKLYALYKQGSAGDVDGKRPGGF
FT                   DFVGGAKYDAWAGLKGKTQEQAQQEYVALVEELKAKDGQ"
     atgaattttg aacaggccca gcaggaagtc aacaccctgt cgaagaagcc cggcaacgac        60
     gtgctcctca agctctacgc cctttacaag cagggcagcg cgggcgacgt ggacggcaag       120
     cgccccggcg gcttcgattt cgtcggcggc gccaagtacg atgcctgggc cggcctcaag       180
     ggcaaaaccc aggaacaggc ccagcaggaa tacgtcgccc tggtcgaaga actgaaggcg       240
     aaagacgggc agtaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page