(data stored in ACNUC30630 zone)

EMBL: AE000513.PE164

AE000513.PE164       Location/Qualifiers
FT   CDS_pept        171755..172111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0169"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="similar to GB:D26185 SP:P28823 GB:M34053 PID:143411
FT                   PID:467467 percent identity: 62.18; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09757"
FT                   /db_xref="GOA:Q9RXY5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXY5"
FT                   /protein_id="AAF09757.1"
FT                   /translation="MSRVVLEGLEFHAHHGVFAAEGVLGARFVVDAELHSPFAGIADDL
FT                   GQAVNYAAAYAAIREEVTEKTHQLIEVLADRIADRLLSDFSRLERVKVRVHKPFAPLPG
FT                   IFRDVYAEIEKERT"
     atgtcccgcg tcgtcctgga aggtctggaa tttcacgccc atcacggcgt tttcgctgct        60
     gagggcgtgc tcggcgcccg cttcgtcgtg gacgccgaac tgcactcccc cttcgccggc       120
     atcgcggacg acctggggca ggccgtcaat tacgccgccg cctacgccgc catccgcgag       180
     gaagtgacgg aaaagaccca ccaactcatc gaggtactgg ccgaccgcat cgccgaccgc       240
     ctcctctccg atttttcccg tctggaaagg gtcaaggtgc gcgtccacaa gcccttcgcg       300
     ccgcttcccg gcatctttcg cgacgtgtac gccgaaatcg agaaggagcg cacgtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page