(data stored in ACNUC30630 zone)

EMBL: AE000513.PE171

AE000513.PE171       Location/Qualifiers
FT   CDS_pept        178048..178443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0177"
FT                   /product="transposase, putative"
FT                   /note="similar to GP:3426012 percent identity: 90.65;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09765"
FT                   /db_xref="GOA:Q9RXX8"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="PDB:2FYX"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX8"
FT                   /protein_id="AAF09765.1"
FT                   /translation="MKKGRGYVYKLEYHLIWATKYRHQVLVDEVADGLKDILRDIATQN
FT                   GLELVALEVMPDYVHLLLGATPQHVIPDFVKALKGASARRMFSAFPHLKQPHWGGNLWN
FT                   PSYCVLTVSEHTRAQIQQYIENQHAAE"
     atgaagaagg gtcgcgggta cgtctacaag ctggaatacc acctcatctg ggcgacgaag        60
     tatcgccatc aggtgttagt ggacgaggtt gcagatggac tgaaagacat cctgcgggac       120
     atcgccaccc agaacggact ggagcttgtc gcgctggagg tcatgcctga ctacgttcac       180
     ctcctgctgg gagccacgcc gcagcatgtc attcccgact ttgtgaaggc gttgaagggg       240
     gcatccgccc gtcgtatgtt ctccgctttt ccgcacctga agcagcccca ctggggcggc       300
     aatctctgga atccgtccta ctgcgtcctg actgtctcgg agcacacccg cgcccagatt       360
     cagcagtaca tcgagaatca gcatgctgcg gaataa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page