(data stored in ACNUC30630 zone)

EMBL: AE000513.PE173

AE000513.PE173       Location/Qualifiers
FT   CDS_pept        179684..180286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653620 percent identity: 62.98;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09767"
FT                   /db_xref="GOA:Q9RXX6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXX6"
FT                   /protein_id="AAF09767.1"
FT                   /translation="MQQQTGGRRRQIRRVVVATSNAGKVRELQGALAPLGWQCEGLGAV
FT                   TLPEETGSTYEENAALKACAAAMATGLPALADDSGIEVLALGGQPGVYSARFGNVNSDV
FT                   ERNVLLLEKMRRHTDRRAKFVSVLVLAYPDGKLEEYRGEVTGQLLEGPRGESGFGYDPL
FT                   FLPDGSELSMGEMTLEQKQAISHRGQALAALLAAHGA"
     atgcaacagc agacaggcgg gcggaggcgg cagatcaggc gcgtggtcgt ggcgacgagc        60
     aatgcgggca aggtgcgtga gctgcagggt gccctcgcgc cgctgggctg gcagtgcgag       120
     ggcctgggcg cggtcacgct gcccgaggag accggcagca cctacgagga aaacgcggcc       180
     ctcaaggcct gcgccgctgc gatggcgact ggcctgcccg cgctcgccga cgactcgggc       240
     atcgaagtgc tcgcgctcgg cgggcagccg ggggtgtact cggcccgctt cggcaacgtg       300
     aatagcgatg tggagcgcaa tgtgctgctg ctggaaaaga tgcgccggca caccgaccgc       360
     cgcgccaagt ttgtgtcggt gctggtcctc gcctatcccg acggcaagct ggaggagtac       420
     cggggcgagg tgacggggca actgctcgaa ggcccgcgtg gcgagagcgg ctttggctac       480
     gaccccctgt ttctgcccga cggctccgag ctgagcatgg gcgagatgac gctggagcag       540
     aagcaggcca tcagccaccg gggccaggcg ctcgcggcgc tgctggccgc ccacggtgcg       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page