(data stored in ACNUC30630 zone)

EMBL: AE000513.PE18

AE000513.PE18        Location/Qualifiers
FT   CDS_pept        complement(18182..19063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09613"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYD1"
FT                   /protein_id="AAF09613.1"
FT                   /translation="MNEEQHEQFRSQVEHLVATGKLTAEEAAELLDGLAGDEPGEPLNL
FT                   APLTAATDTPPNLHLDVTGYALHVVQDSAAPHPQLHVSEPGRVELTATPQGWQVREVKD
FT                   TARRGWLGGDWRNVRAVLTLPFAPRDVQAEVHGGQVALPGLGGELQITLHGGNVRTAAM
FT                   ASLSARIQGGNLSVGAVMGGTDLTVHGGNVSVAGSTALSARIHGGNLNWNGELASGEHQ
FT                   LKLHGGNARLALRPDSSLRVDARVTGGLFAADFATRKSGEFGSARYQGQLGDGAALLSC
FT                   QVAGGQIRLGTA"
     atgaacgaag agcagcacga gcagttccgt tcccaggtcg aacatctggt cgccacaggc        60
     aaactcaccg ctgaggaagc cgccgagttg ctggacggtc tggccggcga tgagcccggc       120
     gaacccctca acctcgcccc gttgacggcg gcgaccgaca cccccccgaa cctgcatctg       180
     gacgtgaccg gctacgcgct gcatgtcgtt caggacagcg ccgcgccgca cccgcaactg       240
     catgtgagcg agccggggcg ggtggaactg accgccacgc cgcagggctg gcaggtgcgt       300
     gaggtgaagg acacggctcg ccggggctgg ctgggcggag actggcgcaa cgtgcgagcg       360
     gtgctgaccc tgccgttcgc gccgcgcgat gtgcaggccg aggtacacgg cggtcaggtg       420
     gccctgccgg gcctcggcgg cgagttgcag atcacgctgc acggcggcaa tgtgaggaca       480
     gcggctatgg cgtccctgag tgctcgcatc cagggcggca atctcagcgt gggcgcagtg       540
     atgggcggca cggacctcac ggtgcacggc ggcaacgtaa gcgtggcggg gagcacggct       600
     ctgagtgccc gcattcacgg cggcaacctg aactggaacg gggaactcgc gtcgggcgag       660
     caccagttga aactgcatgg gggcaatgcc cggctagccc tccgtccgga cagttcgctg       720
     cgggtggacg cccgggttac cgggggcctg ttcgccgccg acttcgccac ccgcaaaagt       780
     ggggagttcg gcagcgcgag gtaccagggg cagctcgggg acggagccgc gctgctgtcc       840
     tgtcaggtgg cgggcggcca gattcggctg gggacagcgt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page