(data stored in ACNUC30630 zone)

EMBL: AE000513.PE182

AE000513.PE182       Location/Qualifiers
FT   CDS_pept        complement(191727..192254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:M95287 GB:M80188 GB:X15371 SP:P26837
FT                   GB:U04278 percent identity: 43.88; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09775"
FT                   /db_xref="GOA:Q9RXW7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW7"
FT                   /protein_id="AAF09775.1"
FT                   /translation="MDLELTYTLGDLDAASALLVRVAQDRVERGEELWPPRSLTPERLE
FT                   RYYPRPGWRVAWHGGEAVGTYVLLDADPLFWPDDPPGEAAYLHKLSVHPGWQGRGLSHT
FT                   LLEHAAAEACALGRSFLRLDTAAERPRLRALYAAAGFREVDVVQAGSWRVARFERRLTA
FT                   GPLPGASAHGER"
     gtggacctgg aactgaccta tacgctgggc gacctggacg cagcctcggc gctgctggtg        60
     cgggtcgcgc aggaccgcgt agagcgcggc gaggaactgt ggcccccgcg cagcctgacc       120
     cccgagcggc tggaacggta ttacccccgc cccggctggc gggtggcgtg gcacggcggc       180
     gaggcggtgg gcacttacgt cctgctggac gccgaccccc ttttctggcc cgacgacccg       240
     cccggcgagg ccgcgtacct gcacaagctg agcgtgcatc ccggctggca ggggcggggg       300
     ctctcacata cgctgctgga acacgcggct gccgaagcct gcgccctggg ccgcagcttt       360
     ttgcgactcg acacggcggc ggagcggccc cggctgcggg cgctgtacgc ggcggcgggc       420
     ttccgggagg tggacgtggt gcaggccggc tcttggcggg tggcccggtt cgagcggcgc       480
     ttgactgctg ggcctctgcc tggagcctcc gctcatgggg agcgctag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page