(data stored in ACNUC30630 zone)

EMBL: AE000513.PE183

AE000513.PE183       Location/Qualifiers
FT   CDS_pept        complement(192257..192814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0189"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="similar to GB:AL009126 percent identity: 48.47;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09776"
FT                   /db_xref="GOA:Q9RXW6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW6"
FT                   /protein_id="AAF09776.1"
FT                   /translation="MTEPAPASPARPAWTRALPPLLAAALVGGLGWALLKPAGNAANGP
FT                   LVGKPAPQFNLTGLDGQPVALADYRGRPVVLNFWASWCGPCREEAPLFAKLAAHPGAPA
FT                   VLGILFNETKPQNARDFARQYGLTYPNLQDPGVATAIAYQVTGIPRTVFIDAQGVVRHI
FT                   DQGGLDTARLNAGLSKIGVPGL"
     atgaccgagc ctgcgcccgc ctcccctgcc cgccccgcct ggacccgcgc cctgccgccg        60
     ctgctggccg ccgcgctggt ggggggcctg ggctgggcgc tgctgaaacc ggcgggcaac       120
     gcggcgaacg ggccgctggt gggcaaaccg gcgccgcagt tcaatctgac gggcctggac       180
     gggcagccgg tcgcgctcgc cgactaccgg ggccggcccg tggtgctgaa cttctgggcg       240
     tcgtggtgcg gcccgtgccg cgaggaagcg ccgctcttcg ccaaacttgc tgcccacccc       300
     ggcgcgcccg ccgtgctcgg cattctgttc aacgaaacga agccgcaaaa tgcccgcgac       360
     tttgcccggc agtacggcct gacctacccc aacctgcaag accccggcgt ggcgacggcc       420
     atcgcctatc aggtcacggg gattccgcgc accgtgttta tcgacgcgca gggcgtggtg       480
     cgccacatcg accagggcgg gctggacacc gcgcgcctca acgcggggct gagcaaaatc       540
     ggcgtgccgg ggctctag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page