(data stored in ACNUC30630 zone)

EMBL: AE000513.PE186

AE000513.PE186       Location/Qualifiers
FT   CDS_pept        196635..197312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0192"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GP:3036882 percent identity: 57.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09779"
FT                   /db_xref="GOA:Q9RXW3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW3"
FT                   /protein_id="AAF09779.1"
FT                   /translation="MSLLTLPPQATEVGLAVDVAAFAMHAGELRVLLVQRGELPHAQTW
FT                   ALPGGFVQPGEELHEAALRELRTETSVSLEPRHLEQFFTFGEVGRDPRGRVVSVAHLAV
FT                   LPHGTVEARAGGHTVGAEWLAAHTPPALAFDHQAILDRAIKRLQLRLDYANLALEFLPD
FT                   TFTLPELQGVYEAIGHRELDKRNFRKRILAAGILTPCGERRSGVGRPAQLYRRAKGTRT
FT                   AAL"
     atgtcgctcc tgacccttcc cccgcaggcc accgaggtcg ggctggcggt ggacgtggcg        60
     gccttcgcca tgcacgcggg cgagttgcgg gtgctgctgg tgcagcgcgg cgagttgccc       120
     cacgcccaga cctgggcact gccgggcggc ttcgtgcagc cgggcgagga actgcatgag       180
     gcggcgctgc gcgaactgag gaccgaaacg agcgtcagcc tggagccccg gcacctggag       240
     cagtttttta ccttcggcga ggtggggcgc gacccgcgcg ggcgcgtcgt aagcgtggcg       300
     cacctcgccg tcttgccgca cggcacggtg gaggcgcgcg caggcgggca caccgtgggg       360
     gccgagtggc tcgccgcgca cacgcctccg gcgctcgcct tcgaccacca ggcgattctg       420
     gaccgcgcca tcaagcggct gcaactgcgg ctcgactacg ccaacctcgc gctcgaattt       480
     ctgcccgaca ccttcaccct gcccgagctg caaggcgtgt acgaggccat tggccaccgc       540
     gaactcgaca agcgtaattt ccgtaagcgc attctcgccg ccggcatcct gaccccctgc       600
     ggcgagcggc gcagcggcgt gggacggccc gcgcagctct accgccgcgc caaaggcacc       660
     cgcacggcgg cgctgtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page