(data stored in ACNUC30630 zone)

EMBL: AE000513.PE193

AE000513.PE193       Location/Qualifiers
FT   CDS_pept        complement(202908..203198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:D26185 SP:P24281 GB:X17014 PID:40073
FT                   PID:467410 percent identity: 70.10; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09786"
FT                   /db_xref="GOA:Q9RXV7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXV7"
FT                   /protein_id="AAF09786.1"
FT                   /translation="MDMKKLMKQMQQAQVAAGKIQDELAAQSVEGTASGLVTVQMNGHG
FT                   KVTSLKIKPEAVDGDDVEALEDLILAAINDAAEKAEGLQREATAGLGLPGF"
     atggacatga agaagttgat gaagcagatg cagcaggcgc aggtcgcggc tggcaagatt        60
     caggacgaac tggcggcgca gtcggtggaa ggcaccgcga gcggcctggt gacggtgcag       120
     atgaacgggc acggcaaggt gaccagcctg aaaatcaagc ccgaagcggt ggacggcgac       180
     gacgtggaag ctctggaaga cctgattctg gccgccatca acgacgccgc cgagaaggcc       240
     gagggcttgc agcgcgaagc gacggcgggc ctgggactgc ccggcttttg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page