(data stored in ACNUC30630 zone)

EMBL: AE000513.PE195

AE000513.PE195       Location/Qualifiers
FT   CDS_pept        complement(203907..204725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09792"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV5"
FT                   /protein_id="AAF09792.1"
FT                   /translation="MMDIFNMLGGMGQAQQTVGNQLGTTPQQTEAALEAAVPLLLGAMT
FT                   RNATQPGGLDALASAVGQHDDSAMLGFQQGQTPDMNEGQKILGHVFGGQQQAAANAIGQ
FT                   RAGIDPQMAMQILMMVAPLILSYLSNRSRAQGGQMGGNMGGQSGGGMSLPGGMGGGLGG
FT                   GLGSILGGLLGGGAAGGLGSVLGGMLGGGQAQAQMPQSQNQNTGMGGGQMFPGFPAGNA
FT                   AQQPQMGQAQMGQAQMGGQGDLLGTLNRTLDRDGDGNALNDLIGMFGGRR"
     atgatggaca ttttcaacat gctcggcggc atgggtcagg cacagcagac ggtcggcaac        60
     caactcggca ccacccccca gcagaccgaa gcggcgctgg aagcggctgt gccgctgctg       120
     ctcggcgcga tgacccgcaa cgcgacccag cccggcggcc tggacgcgct cgcgtcggcg       180
     gtcggccagc acgacgacag cgccatgctc ggctttcagc aggggcagac acccgacatg       240
     aacgagggcc agaaaatcct gggccacgtg ttcggcgggc agcagcaggc ggcggccaac       300
     gccatcggcc agcgggcggg cattgacccc cagatggcga tgcagattct gatgatggtc       360
     gcgcccctga ttctgagcta cctcagcaac cgctcccgtg cccagggtgg gcagatgggc       420
     ggcaacatgg gcggacagtc gggcggcggc atgagccttc ctggtggcat gggcggcggt       480
     ctgggcgggg gcctcggctc catcctcggc gggctgctcg gtggcggcgc ggcgggcggc       540
     ctcggcagtg tgctgggcgg gatgctcggc gggggtcagg cgcaagcaca gatgccgcag       600
     tctcagaacc agaacaccgg catgggcggc ggccagatgt tccccggctt tccggcgggc       660
     aacgcagcgc agcagcccca gatgggtcag gcacagatgg gccaagctca aatgggcggt       720
     cagggcgacc tgctcggcac cctcaaccgc acgctggacc gcgacggtga cggcaacgcg       780
     ctgaacgacc ttattgggat gtttggcgga cgccgctaa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page