(data stored in ACNUC30630 zone)

EMBL: AE000513.PE20

AE000513.PE20        Location/Qualifiers
FT   CDS_pept        20768..21034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09624"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC9"
FT                   /protein_id="AAF09624.1"
FT                   /translation="MTAASLPCDIVSLRMAHCRAEHAAGSRQYHLAVLHYRTCLEVAER
FT                   REDCRAMQFFALRLAECYDEMGLRTKAHSFRHLADADDTALLG"
     atgactgccg cgagccttcc ctgcgacatc gtgtccctcc gcatggccca ctgccgtgcc        60
     gagcacgccg ccggaagtcg gcagtatcac ctcgcggtgc tgcattaccg cacctgcctc       120
     gaagtcgccg agcgccgcga agactgccgc gccatgcagt ttttcgcgct gcgcctcgcc       180
     gagtgctatg acgaaatggg cctgagaacc aaggcgcact ctttccgtca tctcgccgac       240
     gccgatgaca ccgctctgct gggctaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page