(data stored in ACNUC30630 zone)

EMBL: AE000513.PE210

AE000513.PE210       Location/Qualifiers
FT   CDS_pept        complement(216981..217424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 63.45;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09799"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXU0"
FT                   /protein_id="AAF09799.1"
FT                   /translation="MTAPAAPLPEKLQNIVGMFKTVPKAMRLQALLEYSRKLPPLPEKY
FT                   AEHPEFLKPVPECTSPFFLVTEQDDAGRVNLHFKVPEDAPTVRGYAGILHEALSGETPE
FT                   TILNVPDNFYMDMGLTELITPMRLRGMGAILMRLKRDVAGAEG"
     atgactgctc ccgccgctcc cctgccggaa aaactccaga acatcgtcgg catgttcaag        60
     accgtgccca aggcaatgcg cctgcaagcg ctgctggaat acagccgcaa gctgccccca       120
     ctgcccgaga agtacgccga acatccagag ttcctcaagc ccgtgcccga atgcaccagc       180
     ccctttttcc tggtgacgga acaggacgac gcgggccggg tcaacctgca cttcaaggtg       240
     ccggaagacg cccccaccgt gcgcggctac gccgggattt tgcacgaggc cctgagcggc       300
     gagacgcccg aaaccatcct gaacgtgccc gacaacttct acatggacat gggcctgacc       360
     gaactcatca cgccgatgcg cctgcgcggc atgggcgcga ttctgatgcg cctcaagcgc       420
     gacgtggcgg gcgcagaggg ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page