(data stored in ACNUC30630 zone)

EMBL: AE000513.PE217

AE000513.PE217       Location/Qualifiers
FT   CDS_pept        complement(224979..225779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0223"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /note="similar to GB:J02732 SP:P12041 PID:143368
FT                   GB:AL009126 percent identity: 74.54; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09809"
FT                   /db_xref="GOA:Q9RXT3"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXT3"
FT                   /protein_id="AAF09809.1"
FT                   /translation="MRLRPTPFPLWRNCTPKASTARPKPLLLLAPLRFRPLARTQRGGV
FT                   MKTAVIQFPGSNCDADALHAARLLLDDGAQFVWHTETALPEGTELVFLPGGFSYGDHLR
FT                   SGAIAARSPIMNAVKAHAEAGGYVLGVCNGFQVLTEAGLLPGALSRNKELHFMCKPVHL
FT                   RVENNATDFSRAYGPGQIIEIPIAHGEGNYYADAATIAELEEGGRVVFRYADNPNGSLN
FT                   DIAGIVNERGNVLGMMPHPERAVELLLGSEDGKGVFESLKTVKK"
     gtgaggctta ggccgactcc gttcccgctt tggcggaact gcacccccaa agcgtccact        60
     gcgcgtccca agcctttgct cctactcgct ccgctcaggt ttcgcccgct ggcgcggact       120
     caacgcggag gcgttatgaa aacagcagtc atccaattcc ccggctccaa ctgcgacgcc       180
     gacgccctgc acgccgcccg gctgctgctc gacgacggcg cacagttcgt ctggcacacc       240
     gaaactgcgc tgcccgaagg cactgaactg gtgtttctgc ccggcggctt ttcctacggc       300
     gaccacctcc gcagcggcgc gattgccgcc cgcagcccca tcatgaacgc cgtcaaggcc       360
     cacgccgagg ctggcggcta cgtgctgggc gtgtgcaacg gctttcaggt gctgaccgaa       420
     gcgggactcc tgcccggcgc gctgagccgc aacaaggaac tgcacttcat gtgtaagccg       480
     gtgcatctgc gggtggaaaa caacgccacc gacttttccc gcgcctacgg gccgggccag       540
     atcatcgaaa tccctatcgc gcacggcgag ggcaactact acgccgatgc cgccaccatt       600
     gccgagctgg aggagggggg ccgcgtggtc ttccgctacg ccgacaaccc caacggcagc       660
     ctgaatgaca tcgctggcat cgtcaacgag cgtggcaacg tgctgggcat gatgccccac       720
     cccgaacggg cggtagagct gctgctgggg agcgaagatg gcaagggcgt atttgaaagt       780
     ctcaagacgg tgaagaaatg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page