(data stored in ACNUC30630 zone)

EMBL: AE000513.PE23

AE000513.PE23        Location/Qualifiers
FT   CDS_pept        22763..23875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0024"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /note="similar to SP:P72158 PID:1621601 percent identity:
FT                   59.05; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09616"
FT                   /db_xref="GOA:Q9RYC6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC6"
FT                   /protein_id="AAF09616.1"
FT                   /translation="MSDQPAATLGILGGGQLAQMLALAALPLGVQVRVLEPDAEAPARL
FT                   CAEHVHAPYTDPAGLDALAACDAVTLEFENVPVESLDALRGRVPVRPGAGLLARSKHRA
FT                   REKAALQEAGARTAPFVVIQREADLDGALDRVGGQGILKTSELGYDGKGQVRVASDTDL
FT                   RQGWAELGQVACILEGFVTFEREVSLAVARTADGRLAFGPLVENVHRDGILRTSVYPAA
FT                   VPDGTEARAREMARAVAEGWGLEGLLTLEFFQVPDGDLLVNEVAPRVHNSGHLTQDGGG
FT                   ASQFEAQVRAVLGLPLSDWSPLLPCAMVNYVGVEGAAPDWAAIDALPGTRVHLYHKAHR
FT                   TGRKLGHVNLAAPDLPTLHQRLAQLEQLIP"
     atgagcgacc aacctgcggc caccctcggc attctgggcg gcggacaact cgctcagatg        60
     ctggccctcg ctgcgctgcc gctgggggtg caggtgcggg tgcttgaacc tgatgcggaa       120
     gccccagccc ggctgtgtgc cgagcatgtg cacgcgccct acaccgaccc ggcggggctg       180
     gacgcgcttg cggcgtgcga cgcggtcacg ctggaattcg aaaatgtccc ggtggagtcg       240
     ctggacgctc tgcggggccg ggtgccggtg cgtcccggag ccgggctgct cgcccgctcc       300
     aagcaccgcg cccgcgagaa ggcggcgctg caagaggcgg gggcgcgcac ggcgcccttc       360
     gtggtcatcc agcgggaagc ggacctggac ggcgctctgg accgggtcgg gggccagggc       420
     atcctcaaaa cctccgaact cgggtacgac ggaaaagggc aggtgcgggt ggcctccgac       480
     accgacctgc gccagggctg ggccgagctg gggcaagtcg cctgcatatt ggaaggcttc       540
     gtcacctttg agcgcgaagt cagcctcgct gtggcgcgca cggcggacgg gcgcctggcc       600
     tttgggccgc tggtggagaa cgtccaccgt gacgggattt tgcggacgtc cgtttacccc       660
     gctgccgtgc cggacggcac cgaagcccgc gcccgcgaga tggcccgcgc cgtggccgag       720
     ggctggggcc tggaagggct gctcacgctg gaattctttc aggtgccgga cggcgacctg       780
     ctggtgaatg aggtcgcgcc ccgtgtccac aactccggcc acctgaccca ggacggcggc       840
     ggtgccagcc agttcgaggc acaggtgcgc gcggtgctgg gcctgccgct gtccgactgg       900
     tctcccctgc tgccctgcgc gatggtcaac tatgtcggtg tggagggggc cgcgcccgac       960
     tgggccgcca ttgacgccct tcccggcacc cgcgtccacc tctatcacaa ggcgcaccgc      1020
     accgggcgca agctgggaca cgtcaatctg gcagcgcccg acctgcccac cttgcatcag      1080
     cggctggcac agctcgaaca gctcatcccc tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page