(data stored in ACNUC30630 zone)

EMBL: AE000513.PE234

AE000513.PE234       Location/Qualifiers
FT   CDS_pept        238308..238655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09833"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR6"
FT                   /protein_id="AAF09833.1"
FT                   /translation="MFAKGGPAMSEFHELQPPHAPRWLPLVLETEVTAATLRYRTRRGG
FT                   PWREVPRADILSADVVHPARWSWPYSRRLDPGSEQLLSTSGRAVRLRLRGGQVLVLGSG
FT                   RAAELLSALRG"
     atgtttgcaa aaggaggccc cgccatgtcc gagttccacg aactgcaacc gccccacgcc        60
     ccgcgctggc tgccgctggt gctggaaacg gaagtgaccg ccgcgaccct gcgttaccgt       120
     acccggcgcg gtggcccctg gcgcgaggtg ccgcgtgccg acatcctgag cgccgacgtg       180
     gtgcaccctg cccgctggag ctggccgtac tcgcgccgcc tggaccccgg cagcgagcaa       240
     ctgctcagca ccagtggtcg ggcagtacgg ctacggttgc gcggcggaca ggtgttggtg       300
     cttggaagtg ggcgggcggc ggagctgctc agcgccttgc ggggttag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page