(data stored in ACNUC30630 zone)

EMBL: AE000513.PE236

AE000513.PE236       Location/Qualifiers
FT   CDS_pept        complement(239002..240990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0243"
FT                   /product="arginine decarboxylase"
FT                   /note="similar to PID:1653772 percent identity: 64.31;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09826"
FT                   /db_xref="GOA:Q9RXR4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXR4"
FT                   /protein_id="AAF09826.1"
FT                   /translation="MCPARLRTPRTASLPTHRRSAMTTANPLNTSFTSADAAELYQVPN
FT                   WSGGWFRVSDKGLMEATPAPGLHASLRAIVDEIVDRGESLPVILRFPQVLAGRVKHLNE
FT                   AFQAAINEYNYSGHYQGVFPIKVNQRRAVVETVAAAGYDYAHGLEAGSKAELALCLAQK
FT                   MHPDALLCCNGFKDDGFIKLALWGRTLGKNVVITIEKFTELDRILKQAKALGVKPAVGV
FT                   RFKLHARGSGQWEESGGDQAKFGLNAYELLRVVERLKEENMLDSLVMLHTHIGSQITDI
FT                   RRVKVAVREAAQTYAGLIAAGADLKYLNVGGGLGVDYDGSKTTFYASMNYTVKEYAADI
FT                   VYTVQEVCKAREVPEPVIVSESGRALTAHHAVLILPVVDVTGPTRNLEDQELTVPGEDS
FT                   HQIVRDMYETLENISMRNYRESYNDAVGDKQTLHNLFDLGYVTLEDRARGEALFNAILR
FT                   KIAKLIQGEKYVPDELEDLQKVLADKFICNFSLFQSLPDNWAIGALFPIVPLDRLNEQP
FT                   TRQATLVDITCDSDGKVEKFIDLRDVKATLPLHEPGDRPYYLGAFLMGAYQDVLGSAHN
FT                   LFGKVSEAHVTVRPGGRFNIDLFVRGQKARRMIESMGYEEPMLRDAIEDQADAAIGRGT
FT                   LTQEQEHELLEDYGEELLGYTYLEYES"
     gtgtgccccg cacggctccg aaccccgcgc acggcgagcc tacctaccca caggaggagc        60
     gctatgacga ctgccaatcc gctcaacacc agctttactt ccgccgacgc cgccgaactc       120
     taccaggtgc ccaactggtc gggcggctgg ttccgcgtgt ccgacaaggg cctgatggag       180
     gccacccccg cgccgggcct gcacgcctcg ctgcgcgcca tcgtggacga aatcgtggac       240
     cggggcgaga gcctgccggt catcctgcgc tttccgcagg tgctcgccgg acgggtcaag       300
     cacctcaacg aggcgtttca ggccgccatc aacgagtaca actactccgg gcattaccag       360
     ggcgtgtttc ccatcaaggt gaaccagcgc cgcgccgtgg tggagacggt ggccgccgcc       420
     gggtacgact acgcgcacgg gctggaagcg ggctccaagg ccgagctcgc gctgtgcctc       480
     gcgcagaaga tgcaccccga cgcgctgctg tgctgcaacg gcttcaagga cgacgggttc       540
     atcaagctcg ccctgtgggg ccggacgctg ggcaagaacg tggtcatcac catcgagaag       600
     ttcaccgaac tcgaccgcat cctcaagcag gcgaaggcgc tcggggtcaa gcccgctgtg       660
     ggcgtgcgct tcaagctgca cgcccggggc tcgggccagt gggaagagtc gggcggcgac       720
     caggccaagt tcggcctcaa cgcctacgag ctgctgcggg tggtcgagcg gctcaaggaa       780
     gagaacatgc tcgactcgct ggtgatgctg cacacccaca tcgggtcgca aatcaccgac       840
     attcgccggg tcaaggtggc ggtgcgcgag gcggcgcaga cctacgcggg cctcatcgcg       900
     gcgggcgccg acctgaaata cctcaacgtg ggcggcggcc tcggcgtgga ctacgacggc       960
     tccaagacga ccttctacgc ctccatgaac tacaccgtca aggaatacgc cgccgacatc      1020
     gtgtacaccg tgcaggaggt gtgcaaggcg cgcgaagtgc ccgagccggt catcgtgtcg      1080
     gaatcggggc gggcgctcac tgcgcaccac gccgtgctga ttttgccggt ggtggacgtg      1140
     accgggccga cgcgcaacct cgaagaccag gaactgacgg tgccgggcga ggacagccac      1200
     cagatcgtgc gcgacatgta cgagacgctg gaaaacatct ccatgcgtaa ctaccgggag      1260
     tcctacaacg acgcggtggg cgacaagcag acgctgcaca acctcttcga cctcggctac      1320
     gtgacccttg aggaccgggc gcgaggcgag gcgctattca acgcgattct gcgcaagatc      1380
     gccaagctga ttcagggcga aaagtatgtg cccgacgaac tcgaagacct gcaaaaggtg      1440
     ctcgccgaca agttcatctg caacttctcg ctgtttcaga gcctgcccga caactgggcc      1500
     atcggggcgc tgtttcccat cgtgccgctc gaccgcctga acgaacaacc cacccggcag      1560
     gccacgctgg tagacatcac ctgcgacagt gatggcaaag tcgagaaatt catcgacctg      1620
     cgcgacgtga aggccacctt gccgctgcac gaacccggcg accggcccta ctacctcggc      1680
     gcgttcctga tgggcgcgta tcaggacgtg ctcggcagcg cccacaacct cttcggcaag      1740
     gtgagcgagg cgcacgtgac ggtgcggccc ggcggacgct tcaacatcga cctcttcgtg      1800
     cgcggccaga aggcgcggcg catgatcgag tcgatgggct acgaggagcc gatgctgcgc      1860
     gacgcgattg aggaccaggc cgacgccgcc atcgggcgcg gcacgctgac gcaggagcag      1920
     gagcacgagc tgcttgagga ctacggcgag gaactgctcg gctacaccta cctggagtac      1980
     gaaagctga                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page