(data stored in ACNUC30630 zone)

EMBL: AE000513.PE239

AE000513.PE239       Location/Qualifiers
FT   CDS_pept        complement(242373..242954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0246"
FT                   /product="Jag-related protein"
FT                   /note="similar to GB:D26185 SP:Q01620 GB:Z14225 PID:467387
FT                   PID:580905 percent identity: 57.53; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09828"
FT                   /db_xref="GOA:Q9RXR1"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXR1"
FT                   /protein_id="AAF09828.1"
FT                   /translation="MDNRTNLDDYLAGLGISDADESALPPPAPDAAPVSAPLHGADEDP
FT                   RAVLEQFLAELTARIDPGLRVQVRETEDALEAEISGENAARLAGRDGRTLGAIEVIAYA
FT                   VLAKHAGRGDLRVRVDVGGFRKRQADTLTKLAERLAVQVAKSGEPHELQPMPPAERRVI
FT                   HIALKENPDVMSESVGEGAARRLVIRPRHG"
     atggacaacc gcaccaatct ggacgactac ctcgcggggc tgggcatcag cgacgccgac        60
     gagagcgccc tgccgccgcc cgctcccgac gcggccccgg tgtccgcccc gctgcacggc       120
     gccgacgagg acccccgcgc cgtgctcgag cagtttctcg ccgagctcac ggcgcgcatc       180
     gaccccgggc tgcgggtgca agtccgcgaa accgaggacg cgctggaagc cgaaatcagc       240
     ggcgagaacg cggcccgcct cgccggacgc gatggccgca cgctgggcgc catcgaggtc       300
     atcgcctacg ccgtgctcgc caagcacgcc gggcgcggcg acctgcgcgt gcgggtggac       360
     gtgggcggct ttcgcaagcg gcaggccgat accctcacca agctggccga gcgcctcgcc       420
     gtgcaggtcg ccaaaagcgg cgagccgcac gagctgcaac cgatgccccc cgccgagcgc       480
     cgcgtgattc acatcgccct gaaggaaaac cccgacgtga tgagcgaatc ggtgggcgag       540
     ggcgccgcgc ggcggctggt gattcggccc cggcacggct aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page