(data stored in ACNUC30630 zone)

EMBL: AE000513.PE250

AE000513.PE250       Location/Qualifiers
FT   CDS_pept        complement(261169..261675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:Q10846 PID:1403442 GB:AL123456 percent
FT                   identity: 49.63; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09844"
FT                   /db_xref="GOA:Q9RXQ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXQ0"
FT                   /protein_id="AAF09844.1"
FT                   /translation="MEMNVPPPSPESDELYALVRTVLRLSRRLRQTLDDPLERALGLNT
FT                   RELLVLSAIMDGYDTPGAVAERHNLPAPTVTRVVTKLVEGGLLSRENDPSDLRRQRLVL
FT                   TPQGERTRSETRRRASATVQEHFGHLDPALVQATLSNLRALEGTLPVPTEKIPTEKNTP
FT                   REVTA"
     atggaaatga atgttcctcc cccctccccc gaatccgacg agctgtacgc gctcgtccgc        60
     acggtgctgc ggctttcccg gcggctgcgg caaacgctgg acgacccgct ggagcgcgcc       120
     ctgggcctga acacccgcga actgctggtg ctttcggcca tcatggacgg ctacgacacg       180
     ccgggcgccg tggccgagcg tcacaacctg cccgccccca ccgtgacccg cgtggtgacc       240
     aaactggtgg aaggcggcct gctcagccgt gaaaacgacc cgagcgacct gcgccggcag       300
     cgactggtgc tcacgccaca gggcgagcgc acccgcagcg agacgcgccg ccgggcgagc       360
     gccaccgtgc aggagcactt cggccacctc gaccccgcgc tggtgcaggc cacgctgagc       420
     aacctgcggg cgctcgaagg cacgctgcct gttcccaccg aaaaaattcc cactgaaaaa       480
     aacactccgc gtgaggtgac cgcatga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page