(data stored in ACNUC30630 zone)

EMBL: AE000513.PE254

AE000513.PE254       Location/Qualifiers
FT   CDS_pept        264954..265340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09852"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP6"
FT                   /protein_id="AAF09852.1"
FT                   /translation="MTCGSSFASMFMAGLFTPGSFVDIEGQHRRFGGHFAALAQFAHLV
FT                   GLLVGQRPNAVRHLIGHVGKLHALDFHAALAAFQRDEAGRDRAVLKDHHEVFVHGSYLS
FT                   ACPGRRPSRALPSPQENAPAGAQT"
     atgacctgcg ggtcgagctt cgcgtcaatg ttcatggccg gactcttcac gccggggagc        60
     ttcgttgata tcgaagggca gcaccgccgc ttcggaggtc actttgcagc gctggcgcag       120
     ttcgctcatc ttgtgggtct gctcgtcggt cagcgcccga atgccgtgcg gcacctcatc       180
     ggtcacgtag ggaaactgca cgccctcgac ttccacgccg cgctcgccgc cttccagcgt       240
     gacgaagcgg gccgggaccg agccgttttg aaggaccatc atgaagtctt cgttcatggg       300
     agttacctta gcgcctgccc tgggcggcgc ccgtcacgcg ccttaccctc gccacaagaa       360
     aacgccccag ccggggcgca gacttga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page