(data stored in ACNUC30630 zone)

EMBL: AE000513.PE256

AE000513.PE256       Location/Qualifiers
FT   CDS_pept        complement(267723..268487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0265"
FT                   /product="histidine utilization repressor HutC, putative"
FT                   /note="similar to GB:AL009126 percent identity: 51.79;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09849"
FT                   /db_xref="GOA:Q9RXP4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP4"
FT                   /protein_id="AAF09849.1"
FT                   /translation="MCVDELNFTITSVSALRGASPEARMAKYPLIKTTLKDRLLGGHYP
FT                   EGLPLPSEPQLAREFEVSRMTARRAIDELEREGYVYRVQGAGTFPTGKRFRQGVFRVRP
FT                   FKEWARHPDHRTTVLRAMQIEATPEIAVILQIDPGDPVIFVHRLRTAGDEALVIEKRYI
FT                   NARMVPNLLERNLAVESIHETMVSMGVPLQRVEQNLEAVNLRQEEADLLRVPLGTAAFL
FT                   LRRTTYSENRRASYANYWVRGDRYAFQDTFEP"
     ttgtgtgtgg atgaactgaa ctttactatt acctcagttt ccgcactccg cggagcttca        60
     ccggaggcac gcatggcgaa gtaccctctc atcaagacga cgctcaaaga ccgactcctc       120
     ggggggcatt acccggaagg tctcccgctc cccagtgagc cgcagcttgc ccgtgaattc       180
     gaagtgtccc gcatgaccgc ccggcgcgcc atcgacgaac tcgagcgcga aggctacgtc       240
     taccgcgtgc agggcgcggg cacctttccc accggcaaac gcttccggca aggcgtgttc       300
     cgggtgcggc ccttcaagga atgggcgcgc caccccgacc accgcaccac cgtgctgcgg       360
     gccatgcaga tcgaggccac cccggaaatc gcggtcattt tgcagatcga ccccggcgac       420
     ccggtgattt tcgtacaccg cctgcgtacg gcgggcgacg aggcgctggt cattgagaag       480
     cgctacatca acgcccgcat ggtgcccaac ctgcttgaac gcaacctcgc tgtcgagagc       540
     atccacgaga cgatggtcag catgggcgtg ccgctgcagc gcgtcgagca aaacctcgaa       600
     gccgtcaacc tgcgtcagga agaggccgac ctgctgcgcg tgccgctcgg cactgccgcc       660
     ttcttgctgc gccgcaccac ctacagcgaa aaccgccggg cgagctacgc caactactgg       720
     gtgcgcggcg accgctacgc cttccaggac accttcgagc cttaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page