(data stored in ACNUC30630 zone)

EMBL: AE000513.PE258

AE000513.PE258       Location/Qualifiers
FT   CDS_pept        complement(271585..272550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09853"
FT                   /db_xref="GOA:Q9RXP2"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP2"
FT                   /protein_id="AAF09853.1"
FT                   /translation="MKRFTVPALVLLGALAGPAQAAAPARTVTIGLGYVPNVQFTPFYV
FT                   ADRLGYFGAEGLNVKFQHGYISELMPLLLQGKLDFVVGDPEDAIFARNQGAPVKYALAM
FT                   YQKSPVTLFSLKPLTNAASLRGKTLGIPGPFGSSYHAVQAYLANAGLKEGRDVRLATIG
FT                   FTQQEAVRSGRVNAAAGYLNNDVVLLRAAGKKVYTLDTFAAYPMVGVGLIAQDKTLGTA
FT                   LAKKVVRASQRGLKYTVQNPAGAFKTAQPVFGKAGGTLDILKASVPLMQSAYTRQNGLG
FT                   AGAPANWTKAVAALVKQGKLPAGAQASTFYTNALIDKAVR"
     atgaagcgtt tcactgttcc ggcgctggtc ctgctcggcg ctctggctgg cccggcccag        60
     gccgcagcac ccgcccgcac cgtcacgatc gggctggggt acgtgcccaa cgtgcagttc       120
     acgccgtttt acgtggctga ccggctgggg tacttcgggg ccgaggggct gaacgtcaag       180
     tttcagcacg gctatatctc tgaactgatg ccgctgctgc ttcagggcaa gctcgacttc       240
     gtggtgggcg accctgagga cgccatcttc gcccgcaacc agggcgcccc ggtcaagtac       300
     gcgctggcga tgtaccagaa aagcccggtg acgctattca gcctcaaacc cttgacgaat       360
     gcggcgtcgc tcaggggcaa gacgctgggg attcccggcc ccttcgggag cagctaccac       420
     gcggtgcagg cgtatctggc gaacgccggg ctgaaagaag gccgcgacgt gcggctcgcc       480
     accatcggct ttacccagca ggaagctgtg cgcagcggac gggtgaacgc cgccgctggc       540
     tacctcaaca acgacgtggt gctgttgcgc gccgccggga aaaaggtcta cacgctcgac       600
     actttcgccg cctacccgat ggtcggggtg ggcctgattg cccaggacaa gacgctcggc       660
     accgcgctgg cgaaaaaagt ggtgcgcgcc agccagcgcg gcctgaagta caccgtgcaa       720
     aaccccgccg gggccttcaa gacggctcag ccggtgttcg gcaaggcggg cggcaccctc       780
     gacatcctga aggcgagcgt cccgctgatg caaagcgcct acactcggca aaacgggctg       840
     ggtgccggcg ccccggccaa ctggaccaag gcggtggccg cgctcgtcaa gcagggcaaa       900
     ctgcccgccg gcgctcaggc gagcaccttc tacaccaacg ccctgatcga caaagcggtg       960
     cgctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page