(data stored in ACNUC30630 zone)

EMBL: AE000513.PE26

AE000513.PE26        Location/Qualifiers
FT   CDS_pept        complement(26166..27968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0027"
FT                   /product="gidA protein"
FT                   /note="similar to GB:D26185 SP:P25812 PID:40026 PID:467385
FT                   GB:AL009126 percent identity: 63.95; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09619"
FT                   /db_xref="GOA:Q9RYC3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYC3"
FT                   /protein_id="AAF09619.1"
FT                   /translation="MKGWNVIVIGGGHAGLEAAWAAAKFSRVALLVGNPATVGRMPCNP
FT                   AVGGPGKSQLVFEVQALGGLMGRLADDTAIHTRMLNASKGPAVQSLRVQNERDAYAERA
FT                   QDVIFGHSEIEIVRGEAADLEQDGQGGWVVVTSDGRRLHARSVVLAAGTFMRGVTWYGR
FT                   QSRPEGRQGEPPSRFLSAPLERGGHVLKRYKTGTPPRVRADSVRFADLLEIPADPQPRG
FT                   FTGTPGPRAAESPTWQTHTTPQTHALIQENLHESPMYAGDIEGLGPRYCPSIEDKVVKF
FT                   AHHDRHLLFVEPDGVQTSEVYLQGFSSSLPPRLQDELVRTLPGFEQAVIQRYAYAVEYD
FT                   VVDSTELTLNLESKKLPGLFTAGQLNGTSGYEEAAAQGLVAGTAAARRSLGLDEQVIGR
FT                   ETSYLGVLLDDLVFKGSDEPYRMMTSRVEHRLLVRQDNADERMTPIGHALGLVDDAELI
FT                   RVQEKYARVQSGIKSLSKQRMQGQTADAWLRRPELSLADVETLGATLPAELGASEREAV
FT                   EIRVKYAGYIARAESQLRSEAKARELSLSGVNFAGITALSNEAREKLTRLQPQTVEQAS
FT                   RISGVRHADISALLVHLKGQRVGS"
     atgaagggct ggaatgtcat cgtcatcggc ggaggccacg cggggctgga agctgcctgg        60
     gccgccgcca aattctcgcg ggtcgcgctg ctcgtcggca acccggcgac ggtgggccgc       120
     atgccctgca acccggcggt gggcgggccg ggcaaaagcc agctcgtctt tgaagtgcag       180
     gcgctcggcg gactgatggg tcgcctcgcc gacgacaccg ccattcacac ccggatgctc       240
     aacgcgagca agggccccgc cgtgcagtcg ctgcgcgtgc agaacgaacg cgacgcctac       300
     gccgaacgcg cccaggacgt gattttcggg cactccgaaa ttgagattgt gcgcggtgaa       360
     gccgccgact tggaacagga tgggcagggc ggctgggtgg tcgtgaccag cgatggccgc       420
     cgcctgcacg cccgcagtgt ggtccttgcc gccggtacct tcatgcgcgg tgtgacctgg       480
     tatggccgcc aatcgcgccc cgagggacga cagggcgagc cgccctcgcg ctttctttca       540
     gctccactgg aacgcggcgg gcacgtgctc aagcgctaca agaccggcac ccctccgcgc       600
     gtccgggccg actcggtgcg ctttgccgac ctgctggaaa ttcccgccga cccgcagccg       660
     cgcggcttta ccggcacgcc cggtccccgc gccgccgagt ctccgacctg gcagacccac       720
     accacaccgc agacgcacgc gctgattcag gaaaacctgc acgagtcgcc catgtatgcc       780
     ggcgacatcg agggcctggg gccacgctac tgtccgagca tcgaggacaa agtggtcaag       840
     ttcgcccacc acgaccgcca cctgctgttc gtggaacccg acggcgtgca gacgagcgag       900
     gtctacctcc agggcttttc ctcctcactg ccgccgcgcc tgcaagacga actggtgcgg       960
     acgctcccag gcttcgagca ggccgtcatt cagcgctacg cctacgcggt ggaatacgac      1020
     gtggtggact ccactgaact caccctcaac ctcgaatcca aaaagctgcc gggcctcttc      1080
     accgccgggc agctcaacgg caccagcggc tacgaggaag cggcggcgca gggcttggtc      1140
     gcagggacgg cggcagcgcg gcgctccctt ggcctggacg aacaggtcat cgggcgggaa      1200
     accagttatc tgggtgtgtt gctcgacgac ctcgtcttca agggcagcga cgaaccctac      1260
     cgcatgatga ccagccgggt ggaacaccgc ctattggtcc gccaggacaa cgccgacgag      1320
     cgcatgacgc ctatcggcca tgcgctgggg ctggttgatg acgccgagtt gataagggtg      1380
     caggagaagt acgctcgggt gcagagcggc atcaaaagcc tcagcaagca gcgcatgcaa      1440
     gggcaaaccg ccgatgcctg gctgcgccgc cccgagctgt cgctggccga cgtagaaact      1500
     ctgggcgcca cactgcccgc cgaactgggt gccagcgagc gcgaagcggt ggaaatccgc      1560
     gtcaagtacg ccggctacat cgcccgcgcc gaatcgcaac tgcgctcaga agccaaagcc      1620
     cgtgaactca gcctcagcgg cgtgaatttc gccggtatta cggccctgtc caacgaagcg      1680
     cgcgaaaaat taacgcgcct gcaaccgcag acagtggagc aggccagccg catttccggt      1740
     gtccgccacg ccgatatcag tgccctgctg gtgcatctga aaggccagcg agtgggaagt      1800
     tag                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page