(data stored in ACNUC30630 zone)

EMBL: AE000513.PE261

AE000513.PE261       Location/Qualifiers
FT   CDS_pept        complement(275110..275949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09867"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN9"
FT                   /protein_id="AAF09867.1"
FT                   /translation="MRILNIPVTPAELGRWRGHLAPPRQPFFLSRADAERLDLPATPRS
FT                   LLQLTPEERDTFTLWAVDQAADQVTWLSPAQWAALPPAGRRELLRLQVRAGRGNVPLGR
FT                   HYSDLVPGLAPGRFLWQRDHLTPAVLARLVSREGVACQREAVPPAVWEAARPLLPRARE
FT                   LAGTFPQGSAGNCFGAVMGAAGLSGAEHEWMQRDPFEAFLRERARQGGQDEQPGTLLVW
FT                   RSERGVEHAAVTLGGGWAFQKAAQTWWTPRAVLPVAEVKRTNRVRGWRLERWQLRPG"
     atgcgcatcc tcaacattcc cgtcacgccc gccgaactgg ggcgctggcg cggccacctc        60
     gccccgccgc gccagccttt tttcctgtcg cgcgccgacg ccgagcggct ggacctgccc       120
     gccacgccgc gcagcctctt gcaactcacg cccgaggaac gcgacacctt cacgctctgg       180
     gcggtggacc aggccgccga ccaggtgacg tggctctccc cggcgcagtg ggccgcgctg       240
     ccgccggctg gccggcgcga actgctgcgg ctgcaagtgc gcgcaggccg gggcaacgtg       300
     ccgctgggcc gccactattc agatttggtg ccgggcctcg cgccagggcg gtttctgtgg       360
     cagcgcgacc acctcacgcc cgccgtgctc gcgcgcctcg tgtcgcggga aggcgtggcg       420
     tgccagcgcg aggccgtgcc gcccgccgtc tgggaagcag cccgccccct gctcccacgc       480
     gcacgcgaac tggccgggac tttcccacag ggcagcgcgg gcaactgctt cggcgcggtg       540
     atgggcgcgg cgggcctcag cggcgccgag catgagtgga tgcagcgcga ccccttcgag       600
     gcttttctgc gcgagcgtgc ccgccagggt gggcaagacg aacagcctgg caccttgctg       660
     gtgtggcgca gcgagcgggg cgtggaacat gccgccgtga cgctgggagg cggctgggct       720
     tttcagaaag ccgcgcagac gtggtggaca ccgcgcgccg tgctgccggt ggccgaggtc       780
     aagcggacga accgcgtcag gggctggcgg ctggagcgct ggcagttgcg tccgggctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page