(data stored in ACNUC30630 zone)

EMBL: AE000513.PE262

AE000513.PE262       Location/Qualifiers
FT   CDS_pept        276011..276340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 58.23;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09855"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN8"
FT                   /protein_id="AAF09855.1"
FT                   /translation="MITVANRIFVNPERAAAFEERFRRRPRRVDRQPGFIADHVLRPTQ
FT                   AGDPYVVLSFWDSRAAFEAWRTSPGFKDGHKGGRTLPEDTVLSNVIEIHEVFTGSDDAG
FT                   TGEES"
     atgattaccg tcgccaaccg cattttcgtg aaccccgagc gggctgccgc cttcgaggag        60
     cgctttcgcc gccgcccccg ccgggtggac cggcagcccg gattcatcgc cgaccacgtg       120
     ctgcgcccta ctcaggccgg cgacccctac gtggtgctgt cgttctggga cagccgcgcg       180
     gcgttcgagg cgtggcgcac ctcgccgggc ttcaaggacg gacacaaggg ggggcggacc       240
     ttgcccgaag acaccgtgct gagcaatgtc atcgagattc acgaggtgtt caccggctca       300
     gacgacgccg ggaccggtga ggaaagctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page