(data stored in ACNUC30630 zone)

EMBL: AE000513.PE27

AE000513.PE27        Location/Qualifiers
FT   CDS_pept        28040..29674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0028"
FT                   /product="aminotransferase, putative"
FT                   /note="similar to GB:AE000511 PID:2313511 percent identity:
FT                   58.47; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09620"
FT                   /db_xref="GOA:Q9RYC2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC2"
FT                   /protein_id="AAF09620.1"
FT                   /translation="MDLATLRAHNSGMDFASLRADLIGSEAVIRTPFGERRVTYADYVA
FT                   SGRALRSVEDQVRRLALPLYANTHTEDSATGAHSTHLTHEAHEYVKAQLGADASCKLVF
FT                   CGSGSTAAVRRMQDILGLSVGCAHRLTVLDALPEHERPVVFVGPYEHHSNEVSWRETLA
FT                   EVVEIPLCARGNLDLDALITALKDPRYARRPKIGSFSAASNVTGLLTDTRTVARILHRH
FT                   GAYAFFDFAASAPYVAIDMKPGQPDGYDAVFLSPHKFVGGPGTPGLLCFRAELYRLSSP
FT                   STAGGGTVRYVSRTKHTFVDDIEAREDAGTPAILGKIRTALAFRVKEELGVRALTEREH
FT                   ELFGRAVTRLGIHPRVQLLGNPDAPRLAFLSFLVKAEDGTYLHPRFVVRLLNDLFGIQA
FT                   RGGCACAGPYGHALLDIDDERSERYFQCVMSDLDGLKPGWTRLNLAPWATDEEVDFLLS
FT                   AIEFVAEHGEKFLPLYDFDWKTGAWTHPQDAAPPSLFGDAVPQRGRGEVPYAAYLREAA
FT                   ERAQMLNVAARRPIPEQVPGDLVFFAY"
     gtggacctgg ccactcttag ggctcacaat agcggcatgg acttcgccag cttaagggcc        60
     gacctcatcg ggtcggaggc cgtcatccgc accccgttcg gcgagcggcg ggtcacttac       120
     gccgactacg tggcctcggg ccgggcgctg cgcagcgtag aagaccaggt gcgccggctc       180
     gcgctgccgc tctacgccaa cacccacacc gaggacagcg cgaccggcgc gcactccacc       240
     cacctgaccc acgaggcgca cgagtacgtc aaggcgcaac tcggcgcgga cgcgagctgc       300
     aaactggtgt tctgcggttc gggcagcacg gcggcggtgc ggagaatgca agacattcta       360
     ggcctcagcg tgggctgcgc tcaccggctg acggtgctgg acgctctgcc cgagcacgag       420
     cgcccggtgg tcttcgtcgg cccctacgag caccactcca acgaggtgag ctggcgcgag       480
     acgctggcgg aagtggtgga gattccgctg tgtgcgcgcg gcaatctgga tttagatgcc       540
     ctgattacgg cgctcaaaga cccccgctac gcccgccgtc ccaaaatcgg ctcgttcagc       600
     gcggcgagca acgtcactgg cctgctcacc gacacccgca ccgtcgcgcg gattttgcac       660
     cggcacgggg cctacgcttt cttcgacttc gcggcgagcg cgccttacgt cgccatcgac       720
     atgaagccgg gacagcccga cggctacgac gcggtgtttc tcagtccgca caagtttgtc       780
     ggcggccccg gaacgcccgg cctgctgtgc ttccgcgcgg agctgtaccg cctcagcagc       840
     cccagcacgg cgggtggcgg cacggtgcgc tatgtgagcc ggacgaaaca caccttcgtg       900
     gacgacatcg aggccaggga agacgccgga acgcccgcca tcctcggcaa gattcgcacg       960
     gcgctcgcct tccgggttaa ggaagaactt ggggtcaggg cgctgaccga gcgcgagcat      1020
     gagctgttcg ggcgggcggt gacgcgactg ggtatccatc cccgcgtgca actcctcggc      1080
     aacccggacg cgccccggct ggccttcctg tcgtttctgg tgaaggccga ggacggcact      1140
     tacctgcacc cgcgcttcgt ggtgcggctg ctcaacgacc ttttcggcat tcaggcgcgc      1200
     ggcggttgcg cctgcgccgg gccgtatggg cacgcgctgc tcgacattga cgacgaacgc      1260
     tctgagcggt atttccagtg cgtgatgagt gacctcgacg gcctcaagcc cggctggacg      1320
     cgcctcaacc ttgccccctg ggccaccgac gaggaagtgg actttctact ctcggccatc      1380
     gaattcgtcg ctgagcacgg cgagaagttc ctgccgctct acgacttcga ttggaagacc      1440
     ggcgcctgga cgcatccgca ggacgctgcg ccgccctcgc tgttcggtga cgcggtgccg      1500
     cagcggggca ggggagaagt gccctacgcc gcatacctgc gcgaggctgc ggagcgggcg      1560
     caaatgctga acgtagcagc gcggcgcccc attccggaac aagtgccggg cgacttggtc      1620
     ttttttgctt actga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page