(data stored in ACNUC30630 zone)

EMBL: AE000513.PE272

AE000513.PE272       Location/Qualifiers
FT   CDS_pept        283026..284030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0282"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="similar to GB:AE000782 percent identity: 59.35;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09864"
FT                   /db_xref="GOA:Q9RXM8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM8"
FT                   /protein_id="AAF09864.1"
FT                   /translation="MMGARGKSTAAWLWIPAFLLAAAVPFLHPSGFTMELLINVMIWSI
FT                   VTYGLNVLLGYTGQLPLAHAGFFGIGAYTVGILTLKHGWSFWAAWPLAVVLCALGGLLL
FT                   GLVAFRTKGDAFSIFTLGVGVIIQQVINKWDALTGGNDGLNGIAPPAGLDTFAHGLGLK
FT                   LNGGFYLLALLALALTVLVAARARHSVFGRSLLAIRGGEDLARSAGIDVFGHKLRAMML
FT                   STAIAGFAGGLYAVYVGFLGSAVTGPVTTFTTLLYLLVGGVGTLLGPLLGTALMYGLTQ
FT                   LLKDLQDYQYIVFGPLLVLLVMFMPQGLVGLWEKVRARRRPVSAPSAAEVSHD"
     atgatgggcg ccagaggcaa gagtacagcg gcgtggctgt ggattccggc atttttgctg        60
     gcggcggcgg tgccgttttt gcaccccagc ggctttacca tggagctgct catcaacgtg       120
     atgatctggt ccatcgtcac ctacgggctc aacgtgctgc tgggctacac cgggcagttg       180
     ccgctggcgc acgccgggtt tttcggcatc ggggcgtata cggtgggcat cctgacgctc       240
     aagcacggct ggagtttctg ggcggcgtgg ccgctggcgg tggtgctgtg cgccctcggc       300
     gggctgctgc tggggctggt ggccttccgc accaagggag acgccttttc catcttcacc       360
     ctcggggtgg gcgtcatcat tcagcaggtc atcaacaagt gggacgccct gaccggcggc       420
     aacgacggcc tcaacgggat tgcgccgccc gccgggctcg atactttcgc gcacgggctg       480
     gggctcaagc tcaatggggg cttttacctg ctggcgctgc tcgcgctcgc actcacggtg       540
     ctggtcgcgg cgcgggcacg gcacagcgtc ttcgggcgtt cgctgctcgc catccggggt       600
     ggggaagacc tcgcccgcag cgccgggatt gacgtgttcg gccataagct gcgggccatg       660
     atgctctcca ccgccatcgc gggcttcgcg ggtgggctgt acgccgtcta cgtgggcttt       720
     ctcggctcgg cggtgacagg gccggtaacc accttcacca cgctgctcta cctgctcgtc       780
     ggcggggtgg gcacgctgct cgggccgctg ctcggtaccg cgctgatgta cgggctgacc       840
     cagctcctca aggacttgca ggactaccag tacatcgtct tcgggccgct gctggtgctg       900
     ctggtgatgt tcatgccgca gggcctcgtc ggcctgtggg aaaaggtccg tgcccggcgc       960
     cgcccggtgt ccgcgccttc cgccgcagag gtgagccatg actaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page