(data stored in ACNUC30630 zone)

EMBL: AE000513.PE283

AE000513.PE283       Location/Qualifiers
FT   CDS_pept        complement(294803..295441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0293"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="similar to GB:U00096 PID:1789046 percent identity:
FT                   44.55; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09874"
FT                   /db_xref="GOA:Q9RXL7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL7"
FT                   /protein_id="AAF09874.1"
FT                   /translation="MPRLNLRSLQERLRPHPRLPALDPASQVLLLDVDGVLIELPDFFC
FT                   SRFPAAPVRAFFADGFQSASTGKSSVLEHLPTLMQAVGREGSPEEFYREWLEYENRPNR
FT                   DMLAATADLRSAGWGVYLATNQEQLRVQHLMTESGLDAVTDGHFASYAVGHRKPSGDYY
FT                   AAVTATLGVAPEQIVFWDDSIENVEAARAAGWSAHLFTSAADFRRRMGM"
     atgcccagac tgaacctccg ctccctgcaa gagcgcttgc ggccacaccc tcgactgccc        60
     gcgctggacc cggcctctca ggtgctgctc ctcgacgtgg acggtgtcct gatcgagctg       120
     cctgatttct tctgctcgcg ctttcccgct gcgcccgtcc gggctttttt cgccgacggc       180
     tttcagtccg cttccaccgg aaaaagcagc gtgctggagc atctgcccac gctgatgcaa       240
     gcggttggcc gcgaggggtc gccggaggag ttttaccggg agtggctgga gtacgaaaac       300
     agaccgaacc gcgacatgct ggccgccacc gctgacttac ggagtgccgg ctggggggtc       360
     tacctggcga ccaatcagga gcaactgcgc gtgcagcacc tgatgaccga gagcggcctg       420
     gacgccgtaa ccgacgggca ttttgccagt tacgccgtcg gccaccgcaa gccgagcggc       480
     gattactacg cggcagtgac cgctaccctc ggcgttgccc ccgaacagat cgttttctgg       540
     gacgacagca tagaaaacgt ggaagcagcg cgggccgccg gctggtcggc gcacctgttc       600
     acgtccgcgg cagattttcg ccgcagaatg ggcatgtag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page