(data stored in ACNUC30630 zone)

EMBL: AE000513.PE284

AE000513.PE284       Location/Qualifiers
FT   CDS_pept        complement(295479..296867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0294"
FT                   /product="pre-B cell enhancing factor-related protein"
FT                   /note="similar to PID:1001780 PID:1001813 percent identity:
FT                   73.45; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09875"
FT                   /db_xref="GOA:Q9RXL6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016471"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041529"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL6"
FT                   /protein_id="AAF09875.1"
FT                   /translation="MTTPLSDLNLILDTDSYKSSHFLQYPPGTTRLFSYLESRGGRYPV
FT                   TRFFGLQYILSRYLTRRVTMEMVEEARAVIEAHGEPFPYEGWRRVVEVHGGKLPLEIRA
FT                   VPEGTLVPIHNVLMSCTNTDPELPWLPGWFETMLMRVWYPTTVCTQSWHIREIIRQALE
FT                   DTSDRAAEELPFKLHDFGSRGVSSRESAGIGGLAHLVNFQGSDTLEALRVGRNYYGAEL
FT                   AGFSIPAAEHSTITSWGKEHEVDAYRNMVRQFGKPGKVYAVVSDSYDLKHAINVHWGET
FT                   LRKEVEESGGTLVVRPDSGDPPAMVRLAVNALAAKYGTTTNSKGFKVLQHVRVIQGDGI
FT                   DESTIRQILQNLYVDGFSAENVTFGMGGALLQKVDRDTQRFAYKASAGLIDGEYRGIYK
FT                   DPVTDPGKRSKDGVLDLVEENGRMVTRQYRTFDTDFPGSLMRTVYRDGELLVQDTLEEI
FT                   RGRG"
     atgaccaccc cgctttcgga cctcaacctg attctggaca ccgactcgta caagtcgagc        60
     cactttttgc agtacccgcc cggcaccacc cggctgtttt catatctgga atcgcgcggc       120
     gggcgctacc cggtcacgcg ctttttcggc ttgcagtaca tcctgagccg ctacctgacc       180
     cgccgggtga cgatggagat ggtcgaagaa gcccgcgccg tcatcgaggc gcacggcgag       240
     ccgtttccct atgagggctg gcggcgagta gtggaggtgc acggcggcaa gctgccgctg       300
     gaaatccgcg cggtgcccga agggacgctg gtgcccatcc acaacgtgct gatgagctgc       360
     accaacaccg accccgagct gccctggctg cccggctggt tcgagacgat gctgatgcgg       420
     gtgtggtatc ccaccaccgt ctgcacccag agctggcata tccgcgaaat cattcggcag       480
     gcgctggaag acacctccga ccgcgccgcc gaggagctgc ccttcaagct gcacgatttc       540
     ggctcgcgcg gcgtgagcag ccgcgaaagc gcgggcatcg gcgggctggc gcatctcgtc       600
     aactttcagg gcagcgacac cctggaggcc ctgcgggtgg gccgcaacta ctacggcgcc       660
     gagctggcgg gcttttctat tcccgccgcc gagcactcca ccatcaccag ctggggcaag       720
     gagcacgagg tggacgccta ccgcaacatg gtccggcagt tcggcaagcc cggtaaggtg       780
     tacgccgtcg tctcggacag ctacgacctg aaacacgcca tcaacgtgca ctggggcgaa       840
     accttgcgga aagaagtcga ggagagcggc ggcaccctgg tcgtccgtcc cgactccggc       900
     gaccccccgg cgatggtgcg cctcgcggtg aacgcgctgg ccgccaagta cggcaccacc       960
     accaactcca agggcttcaa ggtgctgcaa cacgtccggg tgattcaggg cgacggcata      1020
     gacgagagca ccattcgcca gattctgcaa aacctgtacg tggacggctt ttccgccgaa      1080
     aacgtcacct tcggcatggg cggggcgctg ctgcaaaagg tggaccgcga cacccagcgc      1140
     ttcgcctaca aggccagcgc gggcctgatc gacggcgaat accggggcat ctacaaagac      1200
     ccggtgaccg accccggcaa gcgcagcaag gacggcgtgc tggatttggt ggaggaaaac      1260
     ggacgcatgg tgacccggca gtaccgcacc ttcgacaccg atttccccgg ctcgctgatg      1320
     cgcaccgtct accgcgacgg cgaactgctg gtgcaggaca cgctggagga gattcgggga      1380
     cgaggatga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page