(data stored in ACNUC30630 zone)

EMBL: AE000513.PE286

AE000513.PE286       Location/Qualifiers
FT   CDS_pept        complement(297765..298061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09881"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL4"
FT                   /protein_id="AAF09881.1"
FT                   /translation="MTQDSADTLLVIDVLDEDAGLADVEDEQGRTFQLPAEWLPGAADG
FT                   QGYRVRAAQGHLTFTPDTDAPRLLRERSKQTLLDFSDEPGADEPEDSQLGEKA"
     atgacgcaag actccgccga caccttgctg gtgattgacg tgctcgacga ggacgccggg        60
     ctcgccgacg tggaagacga gcagggccgc acctttcaac ttcccgccga gtggctgccc       120
     ggcgccgccg acggccaggg ctaccgcgtg cgggcggcgc agggccacct gaccttcact       180
     cccgacaccg acgcgcctcg gctcctgcgc gagcgcagca agcagacttt gctcgacttc       240
     tctgatgaac ctggggccga tgagccagag gacagccagc tcggggaaaa ggcgtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page