(data stored in ACNUC30630 zone)

EMBL: AE000513.PE290

AE000513.PE290       Location/Qualifiers
FT   CDS_pept        complement(302072..302368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0301"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09888"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL0"
FT                   /protein_id="AAF09888.1"
FT                   /translation="MRDGLSPSRPPVLPGTAPSRRSPPPRRTPLMPTYLYKDLNTGEIY
FT                   ELVQHMRDDPYTEHPETGAPVKRVLSRPAIAFKGSGFYVNDSRKSGGEGGGGE"
     gtgcgagacg ggctttctcc atcccgaccc cctgttttgc cggggacggc gcccagccgg        60
     cgctcgcccc cgccccgaag gaccccactg atgcccacct acctctacaa agacctgaac       120
     accggcgaaa tctacgaact cgtgcagcac atgcgcgacg acccctacac cgagcacccc       180
     gaaaccggcg cgccggtcaa acgggtgctg tcgcgcccgg ccatcgcctt taaaggcagc       240
     ggcttttacg tcaacgactc gcgcaagtcg ggcggcgagg ggggcggcgg cgagtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page