(data stored in ACNUC30630 zone)

EMBL: AE000513.PE305

AE000513.PE305       Location/Qualifiers
FT   CDS_pept        315762..316511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0317"
FT                   /product="ribosomal protein S3"
FT                   /note="similar to PID:1652421 percent identity: 68.22;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09898"
FT                   /db_xref="GOA:Q9RXJ6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ6"
FT                   /protein_id="AAF09898.1"
FT                   /translation="MGNKINPNGFRLGVTKGWNSRWYAGKKQYASLLKEDEQIRQLINK
FT                   KLAAAGIARIEIERAGQQVNVIISAAKPGVVIGKGGESIKELRGDIERLVSAGTVAVNV
FT                   AEIPNPNISAPLVALRIAEQIERRFAFRRAMKQAAQRVMESGARGVKVILSGRLGGAEQ
FT                   ARTEKVLEGRVPLHTLRADIDYGTALARTTYGILGIKVLVFNGEVIGGKTETFARPQRR
FT                   DRDERRPEGGDRPARRRPTARRRTGGE"
     atgggtaaca agatcaaccc caacggcttc cgcctcggcg tgacgaaggg ctggaacagc        60
     cgctggtacg ccggcaagaa gcagtacgcc agcctgctca aggaagacga gcagatccgt       120
     cagctgatca acaagaagct ggccgccgct ggcatcgccc gcatcgaaat cgaacgcgcc       180
     ggccagcagg tcaacgtgat catctccgcc gccaagcccg gcgtggtgat cggtaagggc       240
     ggcgagagca tcaaggaact gcgcggtgac atcgagcgtc tggtgtctgc cggtacggtg       300
     gccgtgaacg tcgccgagat ccccaacccc aatatcagtg ccccgctggt cgccctgcgc       360
     atcgccgagc agatcgagcg ccgcttcgcg ttccgccgcg ccatgaagca ggccgcgcag       420
     cgcgtgatgg agtcgggcgc ccgcggcgtc aaggtgatcc tcagcggtcg cctcggcggc       480
     gccgagcagg cccgcaccga gaaggtgctc gaaggccgcg tgcccctgca caccctgcgc       540
     gccgacatcg actacggcac cgcgctggcc cggactacct acggcatcct gggcatcaag       600
     gtgctggtgt tcaacggtga agtgatcggc ggcaagaccg aaacctttgc ccgtcctcag       660
     cgccgtgacc gcgacgagcg ccgtcctgaa ggtggcgacc gcccggcccg ccgccgtccg       720
     accgcgcgcc gccgcaccgg aggtgaatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page