(data stored in ACNUC30630 zone)

EMBL: AE000513.PE310

AE000513.PE310       Location/Qualifiers
FT   CDS_pept        317814..318161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0322"
FT                   /product="ribosomal protein L24"
FT                   /note="similar to SP:P04455 percent identity: 73.53;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09903"
FT                   /db_xref="GOA:Q9RXJ1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:1GS2"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2D3O"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ1"
FT                   /protein_id="AAF09903.1"
FT                   /translation="MPRPSAGSHHNDKLHFKKGDTVIVLSGKHKGQTGKVLLALPRDQK
FT                   VVVEGVNVITKNVKPSMTNPQGGQEQRELALHASKVALVDPETGKATRVRKQIVDGKKV
FT                   RVAVASGKTID"
     atgccccgtc ctagcgctgg cagccaccac aacgacaagc tgcatttcaa gaagggtgac        60
     accgtcatcg tcctgagcgg caagcacaag ggtcagaccg gtaaggtgct gctcgccctg       120
     ccccgcgacc agaaggtcgt cgtggaaggc gtgaacgtga tcaccaagaa cgtcaagccc       180
     agcatgacca accctcaggg cggtcaggaa cagcgcgagc tggccctgca cgccagcaag       240
     gtggcgctgg tggaccccga aaccgggaag gccacccgtg tccgcaagca gatcgtcgac       300
     ggcaagaaag tgcgcgtcgc ggtcgcgagc ggtaagacca tcgactaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page