(data stored in ACNUC30630 zone)

EMBL: AE000513.PE320

AE000513.PE320       Location/Qualifiers
FT   CDS_pept        326390..328327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 68.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09911"
FT                   /db_xref="GOA:Q9RXI1"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI1"
FT                   /protein_id="AAF09911.1"
FT                   /translation="MSHALGPAVGTFAPRPAHYPLLMSRPARQFPDIQSFMRVLEERGE
FT                   LLRVREPVSRDLEITEISDRLVKKGGPAVLFENVVGSDYPVVMGLMGTRERMALAVGVN
FT                   DLDELAQKIRALIDLGGGGSRFGLLSNLPKLRDAMNLPPRRVKTAPVQEVVWRGDEVDL
FT                   SKIPVLKCWPEDGGPFVTFPLVITKDPETGERNMGMYRMQVMSKNTTGMHWQRHKTGTR
FT                   HLEKARQRGQRLEVAVAIGGDPALIYAATAPIPPVPGLNEFAVAGYLRGQRYPVVKGLT
FT                   VDLEVPANAEFVLEGYVDPQEDWVVEGPFGDHTGFYTLADLYPLFHVTCVTMRQNPVYP
FT                   ATIVGRPPMEDAYLIEASERLFLPAAQLIVPEIVDYHMPPAGVAHNLVVVSIKKDFPGQ
FT                   AYKVANGLLGLGQMMFAKVIVVVDADVKVNDMDAVWREVAAKAVPGRDTLTGRGPIDVL
FT                   DHSSRGWGYGGKLIIDATTKRPEETGSGVSSREGQAEDFAPDAPFVPFASADLPTFDGV
FT                   VAQRQTDDGYWFVALNKTRPGQARELAQAFAVHPAARGVRHLLIADQDTDVNDAGDVWW
FT                   TVLNNIDPERDVWHLPAEAGGGGLAWDGARKLPEEGFVREWPQKIVMDEAVRRRVDALW
FT                   HVWGLPEQWR"
     atgtcacatg ccctaggccc agccgtcggc acctttgccc cccgccccgc ccactatcct        60
     ctgctcatgt cccgtcctgc ccggcagttt cccgacatcc agtccttcat gcgcgtgcta       120
     gaggagcgcg gcgagctgct gcgggtccgt gagcccgtct cacgtgacct ggaaatcacc       180
     gaaatcagcg accggctggt gaaaaaaggc ggcccggcgg tgctgttcga gaacgtcgtc       240
     ggcagcgact acccggtggt gatgggcctg atgggcaccc gcgagcgcat ggccctggcg       300
     gtgggtgtga acgacctgga cgagctggcg cagaaaatcc gggcgctgat tgacctgggc       360
     ggcgggggca gccgattcgg cctgctgagc aacctgccca agctcaggga cgccatgaac       420
     ctgccgcccc gccgcgtgaa aacggccccg gtgcaggaag tcgtgtggcg cggcgacgaa       480
     gtggacctgt ccaaaattcc ggtgctgaaa tgctggccgg aagacggcgg cccgttcgtg       540
     acttttccgc tggtcatcac caaagacccc gaaaccggcg agcgcaacat gggcatgtac       600
     cgcatgcagg tcatgagcaa aaacaccacc gggatgcact ggcagcgcca caagaccggc       660
     acccggcacc tggaaaaggc gcgtcagcgc gggcagcggc tggaagtcgc ggtggcgatt       720
     ggtggcgacc ccgcgctgat ctacgcggcc accgcgccga ttccgccggt gccgggcctc       780
     aacgaatttg ccgtggccgg gtatctgcgt gggcagcgct atccggtggt gaaggggctg       840
     acggtggacc tcgaagtgcc cgccaacgcc gaattcgtgc tggaaggcta cgtggacccg       900
     caggaggact gggtggtcga ggggccgttc ggcgaccaca ccggctttta cacgctggcc       960
     gacctctacc cgctgtttca cgtgacctgc gtgaccatgc ggcaaaatcc cgtgtacccc      1020
     gccaccatcg tgggccgccc gccgatggag gacgcttacc tcatcgaagc gtccgagcgg      1080
     ctgtttctgc ccgccgcgca gctcatcgtt ccggaaatcg tggactacca catgccgccc      1140
     gccggggtcg cgcacaatct ggtcgtcgtg agcatcaaaa aagactttcc ggggcaggcc      1200
     tacaaggtcg ccaacgggct gctggggctg ggccagatga tgttcgccaa ggtcatcgtg      1260
     gtggtagacg cggatgtgaa ggtcaatgac atggacgccg tgtggcgcga ggtggcggcc      1320
     aaagcggtgc ccgggcgcga caccctgacc ggacgcgggc cgatagacgt gctcgaccac      1380
     tccagccgcg gctggggcta cggcggcaaa ctgattatcg acgcgaccac caagcgcccg      1440
     gaggaaaccg gcagcggcgt gagcagccgt gaaggacagg cggaggactt cgcgcccgac      1500
     gcaccgttcg tgccgttcgc ctccgccgac ctgcccacct tcgacggcgt ggtggcgcag      1560
     cggcagaccg acgacggcta ctggttcgtt gccctgaaca agacccggcc cggacaggcg      1620
     cgtgaactgg cgcaggcgtt cgcggtccac ccggcggcgc ggggcgtgcg gcacctcttg      1680
     attgccgatc aggacaccga cgtgaacgac gcgggcgacg tgtggtggac ggtcctgaac      1740
     aacatcgacc ccgagcgcga cgtgtggcac ctccctgccg aggcaggcgg cggaggcctc      1800
     gcctgggacg gcgcccgcaa attgcccgaa gaaggtttcg tgcgcgagtg gccgcagaag      1860
     atcgtgatgg acgaggcagt gcgccgccgg gtggacgcgc tgtggcacgt gtggggcttg      1920
     ccggagcagt ggcgttga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page