(data stored in ACNUC30630 zone)

EMBL: AE000513.PE338

AE000513.PE338       Location/Qualifiers
FT   CDS_pept        complement(349031..350746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 41.33;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09932"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG3"
FT                   /protein_id="AAF09932.1"
FT                   /translation="MTGPDSSKPAGQGAAPEPSQTQPTPTPALPTQPIDGKYQVLRELS
FT                   RAGNVTLYEVRAAEGVTRRVAWFEVQTPAERQSFHAYRTALRTAAPAGLTDVVARPGAY
FT                   YAVWQDVPGTPLAEVAAQPTKRQEMIEAVEALGTRLADAGFALSDADIVLQGDQPQVAY
FT                   LRPVPPRTPEQIATLNAGVLGDLRDGKVKRKRERRPGAWLTFVPGLVFLAGASWLGAQA
FT                   AKVYLNPPVGEVSNVISQPAADAARALTKKGFRVEYAYGENGNQPIGVVIRQEPDGGTS
FT                   LPTGRLVVLTVNKPAPLTVPKVEDMTLTQAQGPLGDSALKLGKVIRVDGTQTRTPEGRI
FT                   IAQIPPAGASTQRSVPVQVLVSTGVRSEETFIPDLRGMTFEQARDWARAAGLVVTDWSR
FT                   EPSDKTENTVLSQEPAPWANVTVGSKVKLVIAGVRTAPPSVPTEPLPIPPPYVPPPPPE
FT                   PITAPEQTPPTQGQPSTQPGTQPGTTPAPDTAAPPAVDTTPRQVNLNYTFPAELPAGIY
FT                   SITVQDASGEREIMPGVPAGQVASRRAQAPIQVQGNAVFIIRRDGGEYARVPVQ"
     atgaccgggc cggattcctc caaaccagcg ggccagggcg cggcgcccga gccttcccag        60
     acgcagccca cgccgacgcc ggcgctgccg actcagccta tcgacggcaa gtatcaggtg       120
     ctgcgcgagc tgtcgcgcgc gggcaacgtg acactctacg aggtccgcgc cgccgagggc       180
     gtgacccggc gggtggcctg gttcgaggtg cagacccccg ccgagcgcca gagctttcac       240
     gcttaccgca cggcgctgcg gacggcggcc cccgccgggc tgaccgacgt ggtggcccgc       300
     cccggcgcgt actacgcggt gtggcaggac gtgccgggca ccccgctcgc cgaggtcgcc       360
     gcgcagccca ccaaacgcca ggaaatgatc gaggcggtcg aggcactcgg cacccggctg       420
     gccgacgcgg gctttgccct gagcgacgcc gacatcgtgc ttcagggcga ccagccacag       480
     gtggcgtacc tgcgcccggt gcccccccgc acgcccgagc agatagccac gctcaacgcg       540
     ggcgtgctcg gtgacctgcg tgacggcaag gtcaaacgca agcgcgagcg gcggcccggc       600
     gcctggctga ccttcgtgcc ggggctggtg ttcctggctg gggcgagctg gctgggcgcg       660
     caggccgcca aggtttacct caacccgccg gtgggcgagg tgtccaacgt gatctcgcag       720
     cccgccgccg acgccgcccg cgccctgacg aaaaagggct tccgggtcga gtacgcctac       780
     ggtgagaacg gcaaccagcc catcggcgtg gtcattcgcc aggaacccga cgggggcact       840
     tcgctgccca cgggccgctt agtcgtcctg accgtcaaca aaccggcgcc gctgaccgtg       900
     cccaaggtcg aggacatgac gctgacccag gcgcaggggc cgctgggcga cagcgccctg       960
     aaactcggca aggtgattcg ggtggacggc acccagacgc gcacgcccga aggccgcatc      1020
     atcgcccaga ttccgcccgc cggcgcctcc acccagcgca gcgtgccggt gcaggtgctc      1080
     gtgagtaccg gcgtccgcag cgaggaaacg ttcattcccg acctgcgcgg catgacgttc      1140
     gagcaggcgc gcgactgggc acgggccgcc gggctggtcg tcaccgactg gagccgtgaa      1200
     cccagtgaca agaccgaaaa caccgtgctc tcgcaggagc ccgccccctg ggccaacgtg      1260
     acggtcggca gcaaggtcaa attggtgatt gctggggtcc gcaccgcgcc gcccagcgtg      1320
     cccaccgagc cgctcccgat tcccccaccc tacgtgcccc caccgccacc cgagccgatc      1380
     accgcgcccg agcagacgcc ccccacccag ggccagccgt ccacacaacc ggggacgcag      1440
     cccggcacga ccccagcgcc cgatacggcg gctccgcctg ctgtggacac caccccccgg      1500
     caggtcaacc tgaactacac cttccccgcc gaactgcccg ccggcatcta ctccatcacg      1560
     gtgcaagacg ccagcggcga gcgcgaaatt atgccggggg tgcctgccgg tcaggtggca      1620
     agccgccgcg ctcaggcgcc gattcaggtg cagggcaacg ccgtgttcat catccggcgc      1680
     gacgggggcg agtacgcgcg ggtgccggta cagtga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page