(data stored in ACNUC30630 zone)

EMBL: AE000513.PE340

AE000513.PE340       Location/Qualifiers
FT   CDS_pept        complement(351536..352009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0352"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09935"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXG1"
FT                   /protein_id="AAF09935.1"
FT                   /translation="MPLERGERGGRSSGPRRVITLERPRNEHLRPVNITVQRMYFGDWT
FT                   TDNMPPEDGYNGPRAGRERGYDRGERRGEGRGYTRGGNDRGAARLNGNGGPGAGRGSQG
FT                   QPRSAAPRAAAPQAPVAAAEPVQNSAPSDAQSEEARRRRRRRGRRGGAPGSAE"
     atgccgctcg aacgcggcga gcgcggtggc cggagcagtg gcccccgccg ggtcatcacc        60
     ctggagcgcc cgcgcaacga gcacctgcgc ccggtcaaca tcaccgtgca gcgcatgtac       120
     ttcggtgact ggaccaccga caacatgccg cccgaagacg gctacaacgg cccccgcgcc       180
     ggacgcgaac gcggctatga ccggggcgag cggcgcggcg aaggccgggg ctacacccgc       240
     ggcggcaacg accggggcgc cgcccgcctg aacggcaacg gtggcccggg cgccggacgt       300
     ggaagccagg gccagccgcg ctccgctgct ccccgcgccg ctgcgcccca ggctcctgtg       360
     gccgccgccg agccggtgca gaacagtgct cccagcgacg cccagagcga ggaagcgcgt       420
     cgccgccgcc gccgccgggg ccgccggggt ggggcaccgg gcagcgccga ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page