(data stored in ACNUC30630 zone)

EMBL: AE000513.PE35

AE000513.PE35        Location/Qualifiers
FT   CDS_pept        36181..36831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0036"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="similar to SP:Q54769 percent identity: 77.22;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09628"
FT                   /db_xref="GOA:Q9RYB4"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYB4"
FT                   /protein_id="AAF09628.1"
FT                   /translation="MPQARGEGATPPTSLPNPSLKGVPLPDNPNNLEPLTREWLAAIGE
FT                   DPDREGLQRTPQRVAKAWAYMTEGYGQTLAQVVGEGVFAAEGSEMVIVKDIEFYSMCEH
FT                   HMLPFYGRAHVAYIPGTRILGLSKFARIVDLYSRRLQVQERITTQVADAVEELLAPKGV
FT                   AVLMEGIHLCMAMRGVQKQNSSTTTSAMRGLFRSDPRTRAEFMSAVQGTLRGR"
     ttgccgcagg caaggggtga gggggccacc ccgccaacgt ctctccccaa cccttccctc        60
     aaaggagtcc ccttgcccga caacccgaac aacctcgaac ccctcacccg tgagtggctt       120
     gccgccatcg gcgaagaccc ggaccgtgaa gggcttcagc gcacgccgca gcgcgtcgcc       180
     aaagcctggg cgtacatgac cgagggctac gggcagacgc tcgcgcaggt ggtgggcgag       240
     ggcgtgtttg ccgccgaggg cagcgagatg gtcattgtca aggacatcga gttttattcg       300
     atgtgcgagc accacatgct gcctttttat ggccgcgccc acgtcgccta cattcccggc       360
     acccggattc tgggcctgag caaattcgcc cgcatcgtgg acctctactc gcgccgcttg       420
     caggtacagg agcggatcac cacgcaggtg gccgacgctg tggaagagct gctggccccc       480
     aagggcgtgg cggtgctgat ggaaggcatt cacctgtgca tggcgatgcg cggcgtgcaa       540
     aagcagaaca gctccacgac gacctcggcc atgcgcggcc tcttccgttc cgacccgcgc       600
     acccgcgccg agttcatgag cgctgtgcag ggaacgctgc ggggccgcta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page