(data stored in ACNUC30630 zone)

EMBL: AE000513.PE364

AE000513.PE364       Location/Qualifiers
FT   CDS_pept        complement(375947..376906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0377"
FT                   /product="L-serine dehydratase, alpha subunit"
FT                   /note="similar to PID:2315866 percent identity: 62.89;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09954"
FT                   /db_xref="GOA:Q9RXD7"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD7"
FT                   /protein_id="AAF09954.1"
FT                   /translation="MTSPTSPPRQDWPRSPPARRSLTMTLEELMNAPAPASRWVLERDC
FT                   AETGLDPADIRAEMLRRIGEMRSSVERGLQSDARSITGMVGWNAKGLWDAPDVLGAPLL
FT                   KRVQAYAMAVNEENARMGRIVAAPTAGSAGTIPGALLGVADHLGLSDEQLVDPMILAAG
FT                   VGKAISKRMFISGAAGGCQAEIGSSAAMAAAAVVELLGGTPRAAVHAASLALMNTIGLV
FT                   CDPVGGYVEVPCVSRNAFFAVHAVSAAQLALAQLESFIPPDEVLGAMASVGRLMPAALR
FT                   ETAEGGLAQTPTGLAVTARMEGKGEGELPGGMVELPLA"
     gtgacttcac cgacatctcc cccgcgccaa gactggccgc gttcgccccc tgcccgaagg        60
     agcctgacca tgacactcga agaactgatg aacgcccccg ccccagcctc gcgctgggtg       120
     ctggaacgcg actgcgccga aaccgggctc gaccccgccg acatccgcgc cgaaatgctg       180
     cgccgcatcg gcgaaatgcg ctcgagtgtg gaacgcgggc tgcaaagcga cgcgcggagc       240
     atcaccggca tggtcggctg gaacgccaag gggctgtggg acgcgcccga cgtgctgggg       300
     gcgccgctgc tcaagcgggt gcaggcctac gcgatggccg tcaacgagga aaacgcccgc       360
     atgggccgca ttgtggccgc gccgacggcg ggcagcgcgg gcaccattcc gggggcgctg       420
     ctgggcgtgg ccgaccacct cggcctgagt gatgagcagc tcgtggaccc gatgattctg       480
     gcggcgggcg tgggcaaggc gatttccaag cgcatgttca tctcgggcgc ggcgggcggc       540
     tgtcaggctg aaatcgggtc gagcgcggcg atggcggcgg cggcggtggt cgagctgctg       600
     ggaggcacgc cccgcgccgc cgtccacgcc gccagcctcg cgctgatgaa caccatcggg       660
     ctggtgtgcg acccggtggg cgggtacgtg gaggtgccgt gcgtgagccg caacgccttt       720
     ttcgccgtcc acgccgtcag tgcggcgcaa ctggcgctgg cgcaactcga aagtttcatt       780
     ccgcccgacg aggtgctcgg cgcgatggcc tcggtgggcc gcctgatgcc cgccgccctg       840
     cgcgaaacgg cggaaggcgg gctggcgcag acgccgacgg gcctcgccgt caccgcccgt       900
     atggagggca aaggcgaggg cgagctgccc ggcggcatgg tggagttgcc actggcgtaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page